BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1327 (674 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 23 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.0 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 23.4 bits (48), Expect = 1.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 472 PSGSTSSQSVETTYSIL*LDKLNFSINNPKN 564 P+GS E Y+IL ++ F IN+ N Sbjct: 319 PAGSNFEIGFENYYNILYFSRIMFHINSAVN 349 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = -2 Query: 238 CGWTTTPEDSPASRSVSAPALAPL 167 C W E P + S AP+ P+ Sbjct: 2276 CDWPENTECHPDASSTMAPSTTPM 2299 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,076 Number of Sequences: 336 Number of extensions: 1456 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -