BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1316 (714 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g21850.1 68415.m02596 DC1 domain-containing protein contains ... 29 3.1 At1g78640.1 68414.m09165 expressed protein ; expression supporte... 28 7.1 At3g60580.1 68416.m06777 zinc finger (C2H2 type) family protein ... 27 9.3 At3g50620.1 68416.m05535 nodulation protein-related contains wea... 27 9.3 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 27 9.3 >At2g21850.1 68415.m02596 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 772 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = +2 Query: 338 EPKRLGTYRCDNCNVKFVSKGALRVHLLTXXXXXXXXXXXAPSDSNTNKTCKICLK 505 E K+ G Y C CN+ F K + V +DS +TC++C K Sbjct: 549 EIKKYG-YHCSTCNISFHIKCSKAVIFPQQTSHNHRFYHFWIADSKITRTCRVCAK 603 >At1g78640.1 68414.m09165 expressed protein ; expression supported by MPSS Length = 487 Score = 27.9 bits (59), Expect = 7.1 Identities = 20/89 (22%), Positives = 37/89 (41%) Frame = +2 Query: 296 VNNERALNGHRDLSEPKRLGTYRCDNCNVKFVSKGALRVHLLTXXXXXXXXXXXAPSDSN 475 +N+ G++DL+E K V + RV LT +S+ Sbjct: 108 INSNVTCAGNKDLTEDIIKFKKMRSLSKEKIVEEKGTRV--LTELPPYTWTIKKTLKESD 165 Query: 476 TNKTCKICLKEYELPSELLRHVLTDHRKR 562 N C++ L + + ++RH+ TD +K+ Sbjct: 166 INHQCRLLLNTTDAENHIMRHLPTDDQKK 194 >At3g60580.1 68416.m06777 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 288 Score = 27.5 bits (58), Expect = 9.3 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 6/60 (10%) Frame = +2 Query: 254 VLTGEDKKKRSK------QPVNNERALNGHRDLSEPKRLGTYRCDNCNVKFVSKGALRVH 415 ++ DK K++K + + E G+ ++ G Y+C+ C F S AL H Sbjct: 132 MMLSRDKWKKNKSNKEVVEEIETEEESEGYNKINRATTKGRYKCETCGKVFKSYQALGGH 191 >At3g50620.1 68416.m05535 nodulation protein-related contains weak similarity to nodulation protein H (EC 2.8.2.-) (Host-specificity of nodulation protein D) (Swiss-Prot:P06237) [Rhizobium meliloti] Length = 340 Score = 27.5 bits (58), Expect = 9.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 654 CSLYVCHQCSRRLLTILLQCSQFV 583 C LY+C C ++L + Q SQ V Sbjct: 38 CGLYICAVCLKQLSNVSFQTSQLV 61 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 27.5 bits (58), Expect = 9.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 351 RRFGSDKSLWPFNARSLFTGC 289 R+FG D S W FN R + C Sbjct: 1933 RKFGHDGSPWEFNLRDVIRSC 1953 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,617,618 Number of Sequences: 28952 Number of extensions: 290198 Number of successful extensions: 886 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 886 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1545769616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -