BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1313 (440 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 1e-41 SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) 32 0.24 SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) 30 0.97 SB_38790| Best HMM Match : E-MAP-115 (HMM E-Value=1.9) 29 2.2 SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 28 3.9 SB_17138| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_40712| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_37931| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) 27 6.9 SB_22851| Best HMM Match : Sad1_UNC (HMM E-Value=0) 27 9.1 >SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 165 bits (401), Expect = 1e-41 Identities = 78/95 (82%), Positives = 87/95 (91%), Gaps = 2/95 (2%) Frame = +1 Query: 160 RNVRSLEKV--CADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGEGSKTWDRFQMRI 333 + VR+ KV CADLI GAK++KL+VKGPVRMPTK LRITTRKTPCGEGSKTWDR++MRI Sbjct: 6 KKVRTTRKVTVCADLIRGAKEKKLKVKGPVRMPTKFLRITTRKTPCGEGSKTWDRYEMRI 65 Query: 334 HKRVIDLHSPSEIAKQITSINIEPGVEVEVTIADA 438 HKR+IDLHSPSEI KQITSI+IEPGVEVEVTIADA Sbjct: 66 HKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 100 >SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) Length = 584 Score = 31.9 bits (69), Expect = 0.24 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 159 SQCALAREGLC*PNQWSQETEAACKGPSPHANQDPAYHHP 278 S C A GLC P + ++ + GPSP + DP+ P Sbjct: 412 SICLCAPSGLCVPIHFLPNSDPSLAGPSPSSKLDPSIRDP 451 >SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) Length = 2436 Score = 29.9 bits (64), Expect = 0.97 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 94 KDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCAD 195 + + K Q E + IH + +T ++VRSLE+ C + Sbjct: 663 RQLHKIQEESTRIHHLAVTALEKDVRSLEQRCLE 696 >SB_38790| Best HMM Match : E-MAP-115 (HMM E-Value=1.9) Length = 198 Score = 28.7 bits (61), Expect = 2.2 Identities = 18/39 (46%), Positives = 21/39 (53%) Frame = +3 Query: 72 GSRCSVRQRHRETPGRGLPYPPHQDHSYFSQCALAREGL 188 GSR R RHR PGR P P S+ ++ A AR GL Sbjct: 2 GSRSHRRARHRGGPGRRRPLKP----SFTTEGAAARLGL 36 >SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 27.9 bits (59), Expect = 3.9 Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = +3 Query: 129 YPPHQDHSYFSQCALAR---EGLC*PNQWSQETEAACKGPSPHANQDPAYHHP 278 Y P +SY + CA + +G + A+ + PH N DPA+ P Sbjct: 267 YDPQNPYSYGAYCAYTQAQPQGFNAQAYPYENNSASARPAMPHYNSDPAHTEP 319 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 27.9 bits (59), Expect = 3.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 234 GPSPHANQDPAYHHP 278 GP PH+ Q P HHP Sbjct: 1189 GPPPHSMQQPLLHHP 1203 >SB_17138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 27.9 bits (59), Expect = 3.9 Identities = 28/104 (26%), Positives = 45/104 (43%), Gaps = 1/104 (0%) Frame = +1 Query: 88 SGKDIEKPQAEVSPIHRIRITLTSR-NVRSLEKVCADLINGAKKQKLRVKGPVRMPTKIL 264 S + +K +VSP+ RI+ TSR ++ S DL + K K K P+ P Sbjct: 124 STRSSKKDPDKVSPLSRIKSPATSRVSLDSDSDDGNDLPSVFTKTKPVWKPPITTPQVNS 183 Query: 265 RITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIAKQITSIN 396 P + + D ++R HKR+ D +S ++ S N Sbjct: 184 DSEEEDLPSYLSTNSQDT-KIRTHKRIADNNSKISCRSKVDSQN 226 >SB_40712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 27.1 bits (57), Expect = 6.9 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 244 RMPTKILRITT-RKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEI 372 R+PT + T +K PC TW R + KR + +H P+ + Sbjct: 22 RVPTAFPSVATGKKYPCQRKKVTWSR-KKNPFKRRVPVHVPTSL 64 >SB_37931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 361 Score = 27.1 bits (57), Expect = 6.9 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +1 Query: 61 TSNMAAAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEK 183 T N A+ ++S + +PQA + P+H I + SRN ++ K Sbjct: 306 TLNSASVILS---LAEPQAGILPVHPHSIEIASRNRDAIAK 343 >SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) Length = 1023 Score = 27.1 bits (57), Expect = 6.9 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 33 KSCLSRPEFNKQHGSRCS-VRQRHRETPGRGLPYPPHQ 143 +S ++ + +H S S V+ R+R G+G+ Y PHQ Sbjct: 744 RSQINVTRYRPRHPSSTSTVKYRYRLWTGKGVDYQPHQ 781 >SB_22851| Best HMM Match : Sad1_UNC (HMM E-Value=0) Length = 1705 Score = 26.6 bits (56), Expect = 9.1 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 25 FD*KVVYLGRNSTSNMAAAVVSGKD-IEKPQAEVSPIHRIRITLTSRNVRSLEK 183 FD K VYL RN+T+ AA+ S K+ I + QA +S + + +R + +L K Sbjct: 1396 FD-KKVYLLRNATTKAEAAIKSQKEQISRLQARLSAMEEANENV-NRKLDTLNK 1447 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,485,782 Number of Sequences: 59808 Number of extensions: 319646 Number of successful extensions: 685 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 859323430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -