BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1311 (670 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 25 0.74 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 25 0.74 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 6.9 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 24.6 bits (51), Expect = 0.74 Identities = 9/39 (23%), Positives = 20/39 (51%) Frame = +3 Query: 495 WLTGIFHRSGHGSNCTSTNGTNIWERVLEGFKSDFVSKI 611 W++G +S + ++C + +W +L FK + K+ Sbjct: 379 WMSGESFKSPYKASCWAQFKAVLWRSILAVFKEPLLIKV 417 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 24.6 bits (51), Expect = 0.74 Identities = 9/39 (23%), Positives = 20/39 (51%) Frame = +3 Query: 495 WLTGIFHRSGHGSNCTSTNGTNIWERVLEGFKSDFVSKI 611 W++G +S + ++C + +W +L FK + K+ Sbjct: 379 WMSGESFKSPYKASCWAQFKAVLWRSILAVFKEPLLIKV 417 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 6.9 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 196 IAMNGS--SGFSIPSHELNDLNNGLRQSSSSSKVNKAPHTPLTN 321 + +NG S +I + ND GL + +SSKV A H+ N Sbjct: 466 VTVNGDVVSHLNITAIHTND--GGLYRCVASSKVGSADHSARIN 507 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,214 Number of Sequences: 336 Number of extensions: 3872 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -