BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1309 (315 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24065.1 68416.m03022 expressed protein ; expression supporte... 27 2.6 At1g76870.1 68414.m08945 hypothetical protein 25 8.1 >At3g24065.1 68416.m03022 expressed protein ; expression supported by MPSS Length = 135 Score = 27.1 bits (57), Expect = 2.6 Identities = 12/47 (25%), Positives = 28/47 (59%) Frame = -3 Query: 301 IMTIRIKSTPKALDSNPYYWKCFTSLI*K*NGVSMTAKSYISKYDTE 161 + T+++ + ALDS+P+ +C +S + + V ++Y+ +DT+ Sbjct: 28 VFTVKVTNN-LALDSHPFTIRCTSSKLDTSSQVLFRGETYVLMFDTD 73 >At1g76870.1 68414.m08945 hypothetical protein Length = 385 Score = 25.4 bits (53), Expect = 8.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +2 Query: 74 TTVAYIVDDSGSDHKF 121 T ++YI +DSGSD KF Sbjct: 98 TALSYIGEDSGSDKKF 113 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,724,530 Number of Sequences: 28952 Number of extensions: 80658 Number of successful extensions: 140 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 330493944 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -