BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1302 (635 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 3.3 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 23 3.3 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 4.3 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 22 5.7 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 7.6 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +1 Query: 331 TWFPSHVSTSSCQVSLPSHPVEADSTV 411 +W P + SSC++++ P + S + Sbjct: 147 SWKPPAIYKSSCEINVEYFPFDEQSCI 173 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 147 FQLAGELRESHCM 109 F G +RESHCM Sbjct: 68 FGCCGAIRESHCM 80 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 4.3 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +2 Query: 47 QNHEHILSSPLAQSIRHCRRTIQCDSLSSPAS*KHRRNLLHRQRG 181 Q H+ +++SPL+Q + + +L SP R+ R+RG Sbjct: 230 QQHQGVVTSPLSQQQQAAPQGAASANLPSPLY-PWMRSQFERKRG 273 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 383 EGSETWHEEVETWEGNHVYGQFSEISVQLTGEPKASGNT 267 +GS T H E+E H+ ++ V + P+ S +T Sbjct: 47 QGSRTTHNELEKNRRAHLRNCLEKLKVLVPLGPETSRHT 85 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 7.6 Identities = 9/35 (25%), Positives = 15/35 (42%) Frame = +1 Query: 307 LISENWP*TWFPSHVSTSSCQVSLPSHPVEADSTV 411 LI N W P + SSC + + P + + + Sbjct: 132 LIYPNGDVLWVPPAIYQSSCTIDVTYFPFDQQTCI 166 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,108 Number of Sequences: 438 Number of extensions: 3829 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -