BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1300 (511 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 73 7e-15 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 23 1.1 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 25 2.0 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 24 2.6 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 24 2.6 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 24 2.6 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 24 2.6 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 24 2.6 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 2.6 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 24 2.6 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 24 2.6 AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylch... 23 4.5 AY331406-1|AAQ97587.1| 96|Anopheles gambiae agCP14332 protein. 23 4.5 AY331405-1|AAQ97586.1| 96|Anopheles gambiae agCP14332 protein. 23 4.5 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 6.0 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 6.0 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 7.9 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 72.5 bits (170), Expect = 7e-15 Identities = 32/64 (50%), Positives = 46/64 (71%) Frame = +1 Query: 316 RMGTLIGVYLPCIQNIFGVILFIRLTWVVGTAGAIQGFLIVLTCCCTTMLTAISMSAIAT 495 + G + GV + C+ NI+GV+LF+RL+WVVG AG QG L++ T +TA+SMSAI+T Sbjct: 187 KFGWIKGVLMRCLLNIWGVMLFLRLSWVVGQAGIAQGVLLICMTTVVTTITALSMSAIST 246 Query: 496 RGVV 507 GV+ Sbjct: 247 NGVI 250 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 23.0 bits (47), Expect(2) = 1.1 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 378 IHPAHLGCRHRWRYTRIP 431 IHPAHL R +Y +P Sbjct: 57 IHPAHLSQRFYEQYKAVP 74 Score = 20.6 bits (41), Expect(2) = 1.1 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +3 Query: 294 PQASPTSPHGHAHRRVPALHPEYL 365 P P P+G+ ++HP +L Sbjct: 39 PYVEPELPYGNFKEMGKSIHPAHL 62 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 24.6 bits (51), Expect = 2.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 288 RCPQASPTSPHGHAHRRV 341 R P P SPHG HR V Sbjct: 26 RHPLVQPRSPHGSGHRIV 43 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 272 HPPQTQMPPSQPH 310 +PP T PPS PH Sbjct: 271 YPPTTNEPPSTPH 283 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 272 HPPQTQMPPSQPH 310 +PP T PPS PH Sbjct: 271 YPPTTNEPPSTPH 283 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 272 HPPQTQMPPSQPH 310 +PP T PPS PH Sbjct: 271 YPPTTNEPPSTPH 283 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 272 HPPQTQMPPSQPH 310 +PP T PPS PH Sbjct: 270 YPPTTNEPPSTPH 282 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 272 HPPQTQMPPSQPH 310 +PP T PPS PH Sbjct: 270 YPPTTNEPPSTPH 282 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 272 HPPQTQMPPSQPH 310 +PP T PPS PH Sbjct: 271 YPPTTNEPPSTPH 283 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 272 HPPQTQMPPSQPH 310 +PP T PPS PH Sbjct: 271 YPPTTNEPPSTPH 283 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 272 HPPQTQMPPSQPH 310 +PP T PPS PH Sbjct: 271 YPPTTSEPPSTPH 283 >AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 9 protein. Length = 406 Score = 23.4 bits (48), Expect = 4.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 479 IDIAVNIVVQQQVRTMRNPCIAPAV 405 IDI N+ +Q+Q T R I PA+ Sbjct: 231 IDITYNVTLQRQSDTHRAIVIVPAL 255 >AY331406-1|AAQ97587.1| 96|Anopheles gambiae agCP14332 protein. Length = 96 Score = 23.4 bits (48), Expect = 4.5 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 231 PQLASGLCEYNPHGIRRRPRC 293 P + +G P +RRR RC Sbjct: 41 PNVENGAANLTPGNVRRRTRC 61 >AY331405-1|AAQ97586.1| 96|Anopheles gambiae agCP14332 protein. Length = 96 Score = 23.4 bits (48), Expect = 4.5 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 231 PQLASGLCEYNPHGIRRRPRC 293 P + +G P +RRR RC Sbjct: 41 PNVENGAANLTPGNVRRRTRC 61 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 6.0 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 288 RC-PQASPTSPHGHAHRRVP 344 RC PQ++P+ PH H + P Sbjct: 6 RCSPQSAPSPPHHHHSSQSP 25 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 6.0 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 288 RC-PQASPTSPHGHAHRRVP 344 RC PQ++P+ PH H + P Sbjct: 6 RCSPQSAPSPPHHHHSSQSP 25 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 22.6 bits (46), Expect = 7.9 Identities = 20/66 (30%), Positives = 27/66 (40%), Gaps = 1/66 (1%) Frame = +3 Query: 105 SPGKKGDPDEHGTTHGTSNKGCDTNL-YALSRRDRGPT*SSHVPQLASGLCEYNPHGIRR 281 +PGK G P HG T G N+ Y+ + D+G + P G C P + Sbjct: 716 APGKDGLPGRHGQT-VKGEPGLKGNVGYSGDKGDKGYSGLKGEP----GRCASIPPNLEE 770 Query: 282 RPRCPQ 299 R PQ Sbjct: 771 AIRGPQ 776 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 571,562 Number of Sequences: 2352 Number of extensions: 11942 Number of successful extensions: 51 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -