BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1297 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0181 + 20985960-20987825,20987904-20989169 28 4.9 07_01_0962 - 8075975-8077282 28 6.5 >11_06_0181 + 20985960-20987825,20987904-20989169 Length = 1043 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 136 GGIYAVMSRSSQKRAKSQTKTFICVYKNNKPESL 237 G S + Q A QTK+ IC + N+KP +L Sbjct: 241 GKCLVTRSEAIQFSAMKQTKSHICAFDNDKPGTL 274 >07_01_0962 - 8075975-8077282 Length = 435 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 423 RTKRSTAAANTSGIWQIFPVKAQRKPGRHPPP 518 R +R AAN + P+ A RKP + PPP Sbjct: 25 RRRRRLLAANATTARGALPLPALRKPTKPPPP 56 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,685,505 Number of Sequences: 37544 Number of extensions: 236415 Number of successful extensions: 442 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 442 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -