BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1297 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 26 1.1 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 25 2.5 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 25.8 bits (54), Expect = 1.1 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +3 Query: 111 FGLMYSSVRWHIRCDV*KQPEKSKKPNKNFHMCV*KQQTRIII 239 F +Y WH++C+V EK P ++ + + T+ I+ Sbjct: 273 FSTLYFPTDWHVQCNVPICAEKWPSPEQDDYYTIALLTTQFIV 315 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 24.6 bits (51), Expect = 2.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 499 GFLWALTGNICQIPDVFAAAVDRFV 425 G + + IC+I D F A V+RFV Sbjct: 143 GKIKLMFSTICEIGDEFLATVNRFV 167 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 541,609 Number of Sequences: 2352 Number of extensions: 10483 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -