BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1297 (598 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-1353|AAF58611.2| 5303|Drosophila melanogaster CG13185-P... 29 3.6 AY122074-1|AAM52586.1| 994|Drosophila melanogaster AT16994p pro... 28 8.4 AE013599-641|AAF59100.3| 994|Drosophila melanogaster CG11641-PA... 28 8.4 >AE013599-1353|AAF58611.2| 5303|Drosophila melanogaster CG13185-PA protein. Length = 5303 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 204 YESFCLAFCSFLAASRHHSVYATVHLSTLS 115 YESFCL+F + L + HH V + + LS Sbjct: 1021 YESFCLSFLTQLDPNSHHVVLLLIQNALLS 1050 >AY122074-1|AAM52586.1| 994|Drosophila melanogaster AT16994p protein. Length = 994 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 476 SC*SPKEAGQTSTANELANKNKLEQINFPLSFS 574 SC +P AG ++TAN L++ N+L N L+ + Sbjct: 698 SCGAPTAAGSSATANVLSSINRLNASNGELTIT 730 >AE013599-641|AAF59100.3| 994|Drosophila melanogaster CG11641-PA protein. Length = 994 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 476 SC*SPKEAGQTSTANELANKNKLEQINFPLSFS 574 SC +P AG ++TAN L++ N+L N L+ + Sbjct: 698 SCGAPTAAGSSATANVLSSINRLNASNGELTIT 730 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,271,938 Number of Sequences: 53049 Number of extensions: 421790 Number of successful extensions: 861 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 861 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2420893683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -