BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1297 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53660.1 68418.m06665 expressed protein 29 2.4 At1g18510.1 68414.m02310 hypothetical protein 28 4.1 >At5g53660.1 68418.m06665 expressed protein Length = 365 Score = 29.1 bits (62), Expect = 2.4 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 129 LSTLSQSSRYITYVDIWSSG 70 L+T Q ++Y+ ++D+WS G Sbjct: 209 LATTEQENKYLNFIDVWSDG 228 >At1g18510.1 68414.m02310 hypothetical protein Length = 238 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 571 KR*WEIYLFQFVFIS*FIGGGCLPGFLWALTGNICQIP 458 KR + IY++ +F+S +GG L F++ T I + P Sbjct: 58 KRMFTIYIYAMIFVSIVLGGYSLKCFIYNTTFGIAKNP 95 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,176,558 Number of Sequences: 28952 Number of extensions: 195215 Number of successful extensions: 419 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -