BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1292 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.5 U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 23 3.4 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 7.8 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 1.5 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 5/29 (17%) Frame = -2 Query: 83 PLVGCPSPEPHNPIR-----SRSISLYVH 12 PL+ +PE H+PIR SRS+ L H Sbjct: 71 PLLRFENPETHHPIRHGRRQSRSMDLNAH 99 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 409 LVGGTRGRTSDRPGQPSECTQSASFQPRYPRRNG 308 + G G + RPGQPS Q A F+ +NG Sbjct: 70 MTGDAYGGLNIRPGQPSR--QHAGFEFGKEYKNG 101 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 7.8 Identities = 6/14 (42%), Positives = 8/14 (57%) Frame = -2 Query: 116 PGCLRWSRPERPLV 75 P +W P RP+V Sbjct: 837 PNLTKWGNPNRPIV 850 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,504 Number of Sequences: 438 Number of extensions: 5262 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -