BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brS-1291
(709 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BT030141-1|ABN49280.1| 374|Drosophila melanogaster IP17450p pro... 29 4.7
>BT030141-1|ABN49280.1| 374|Drosophila melanogaster IP17450p
protein.
Length = 374
Score = 29.5 bits (63), Expect = 4.7
Identities = 17/64 (26%), Positives = 26/64 (40%)
Frame = +2
Query: 389 LFLTILLGFYFTILQAYEYIEASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLICYIRH 568
+FL + T YEY E F + R+ GS FF + ++I L +
Sbjct: 215 IFLPVFCNLQLT--STYEYFEMRFNKSVRLLGSAFFTGANLIWLPIVIYVPALAFNQVTG 272
Query: 569 LNNH 580
+N H
Sbjct: 273 INIH 276
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,922,309
Number of Sequences: 53049
Number of extensions: 338950
Number of successful extensions: 647
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 639
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 647
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3128965752
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -