BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1289 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 27 0.19 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 24 1.0 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 22 4.2 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 22 4.2 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 22 4.2 X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. 21 9.7 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 21 9.7 AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A prot... 21 9.7 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 21 9.7 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 26.6 bits (56), Expect = 0.19 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -3 Query: 182 SPPLRPCSALLSASSNMSCCEPEAPAPASCENVMPVSIST 63 SPP P SA SS+ AP PA+ + P S+++ Sbjct: 10 SPPPAPQSAATPISSSGMTSPAAAPPPATTSSGSPASVAS 49 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -3 Query: 680 KARRCCRYSCKSVMLVFTETLFSHSNSAHICLKS 579 K R+ CR ++ ++ T+ + S + H+C S Sbjct: 33 KYRKFCRILKYFIIAIYVLTILTSSVTLHVCFNS 66 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 22.2 bits (45), Expect = 4.2 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 13 LLEDVDKEREPKRQEQKVEIETGITFSQLAGAGASGSQH 129 LL D+D R + ++ I SQL G+SG Q+ Sbjct: 134 LLMDIDSLITKWRYNHVLMVQRMIGSSQLGTGGSSGYQY 172 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.2 bits (45), Expect = 4.2 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 13 LLEDVDKEREPKRQEQKVEIETGITFSQLAGAGASGSQH 129 LL D+D R + ++ I SQL G+SG Q+ Sbjct: 294 LLMDIDSLITKWRYNHVLMVQRMIGSSQLGTGGSSGYQY 332 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.2 bits (45), Expect = 4.2 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 13 LLEDVDKEREPKRQEQKVEIETGITFSQLAGAGASGSQH 129 LL D+D R + ++ I SQL G+SG Q+ Sbjct: 294 LLMDIDSLITKWRYNHVLMVQRMIGSSQLGTGGSSGYQY 332 >X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. Length = 133 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/47 (21%), Positives = 22/47 (46%) Frame = +1 Query: 19 EDVDKEREPKRQEQKVEIETGITFSQLAGAGASGSQHDMFELALNKA 159 E +ERE + + ++ + E Q + HD +++L+K+ Sbjct: 73 EQARREREEQERHKQQQQEKQQKIEQQTHSSIHQHHHDPMKMSLDKS 119 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 580 DFRQMWAEFEWEN 618 DF MWA F EN Sbjct: 203 DFHAMWAGFTAEN 215 >AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A protein. Length = 284 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/47 (21%), Positives = 22/47 (46%) Frame = +1 Query: 19 EDVDKEREPKRQEQKVEIETGITFSQLAGAGASGSQHDMFELALNKA 159 E +ERE + + ++ + E Q + HD +++L+K+ Sbjct: 224 EQARREREEQERHKQQQQEKQQKIEQQTHSSIHQHHHDPMKMSLDKS 270 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/47 (21%), Positives = 22/47 (46%) Frame = +1 Query: 19 EDVDKEREPKRQEQKVEIETGITFSQLAGAGASGSQHDMFELALNKA 159 E +ERE + + ++ + E Q + HD +++L+K+ Sbjct: 283 EQARREREEQERHKQQQQEKQQKIEQQTHSSIHQHHHDPMKMSLDKS 329 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,742 Number of Sequences: 336 Number of extensions: 1923 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -