BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1288 (591 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3752| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 >SB_3752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 29.5 bits (63), Expect = 2.1 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Frame = +3 Query: 300 AALRTTGIRKNDARVKEVMHSLYKVHKESNFEG--GSPETLKLDRKTFKEVIAPNIVL-I 470 A L G+ ++ ++KE M +L K K S E P T+ L + KEV+ P+I + Sbjct: 552 AILHDYGVELSEEKMKEYMKAL-KTKKFSKLEFCLRHPYTIALVEQNLKEVLVPSISRNL 610 Query: 471 TRAFRSQFVI 500 T RS+ ++ Sbjct: 611 TNKLRSKLLM 620 >SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1263 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 479 FPKSVRNSRLPRFYQGHRGNVLG 547 FP+S+R+ +L RFY R + LG Sbjct: 967 FPQSIRDMKLTRFYLRRRNSPLG 989 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,382,262 Number of Sequences: 59808 Number of extensions: 373508 Number of successful extensions: 1026 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1026 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -