Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-1287
         (610 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_1609 + 28128275-28128380,28128941-28129128,28129238-281294...    28   6.7  

>07_03_1609 +
           28128275-28128380,28128941-28129128,28129238-28129415,
           28130753-28130973
          Length = 230

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 5/56 (8%)
 Frame = +1

Query: 1   DAFECHAFTLALS-----LSSMVALNV*RNLVGSRIRSFTSKKSRVKLCSCFIGSI 153
           D F  H +  AL       +S+VAL V  ++ G  I  F  KK     C C  G +
Sbjct: 125 DVFGAHCWLAALQRACDRYASLVALGVPHHITGETIILFKKKKKIRDSCPCDTGEV 180


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,616,948
Number of Sequences: 37544
Number of extensions: 239916
Number of successful extensions: 467
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 457
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 467
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1454766756
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)