BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1287 (610 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26794| Best HMM Match : DENN (HMM E-Value=1.4e-38) 29 2.2 SB_24542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 >SB_26794| Best HMM Match : DENN (HMM E-Value=1.4e-38) Length = 595 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/53 (26%), Positives = 28/53 (52%) Frame = -1 Query: 265 NYPT*DTRSKYLFELIALKYDERRLPTYHGACNNKKLRYFQ*NNCIVLPYSFL 107 ++P + K+L +L + +++P GA + LR+ +NC++L Y L Sbjct: 290 HWPFFEAFKKFLSQLYRISVSAQQIPIESGASYSAMLRHLGPDNCLLLFYLIL 342 >SB_24542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 81 NKVALNI*RYHTRKRQSESKCVAL 10 N V+ I RYH R + ES+CV L Sbjct: 30 NTVSTRIKRYHDRGKSEESRCVTL 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,429,799 Number of Sequences: 59808 Number of extensions: 302418 Number of successful extensions: 614 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 614 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -