BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1281 (630 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11) 29 2.4 SB_47920| Best HMM Match : Kelch_1 (HMM E-Value=1.9e-34) 29 3.1 SB_44755| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_14525| Best HMM Match : Phospholip_A2_1 (HMM E-Value=2.2) 27 9.5 >SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11) Length = 1771 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/60 (25%), Positives = 35/60 (58%) Frame = -3 Query: 322 SPSPFFASLSLRIYTTCDGQRRSFSPVVITRLRPCAADEYSPRTSISFDRLSCSILTVLM 143 +P P F +LS R++ + + + R+FS + C++ + P +++ + +C++LT L+ Sbjct: 537 APRPAFQNLSPRLFRSLNNRARAFSSEACFWV-TCSS-HFLPPSAVRYWAKACAVLTCLL 594 >SB_47920| Best HMM Match : Kelch_1 (HMM E-Value=1.9e-34) Length = 405 Score = 29.1 bits (62), Expect = 3.1 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = +3 Query: 180 KLIDVLGEYSSAAQGLNRVITTGE-KLRLCPSHVVYILKDKDAKNGEGEAVGMLKIGRKH 356 KL L ++ A+Q +RVITTG +C S V+ + G G G + H Sbjct: 51 KLFRELWRFNIASQCWSRVITTGPFPSSVCSSCVLLNKGNLIVYGGSGIPFGQSNSAQLH 110 Query: 357 LFLFDDKEQVRELE 398 + L KE + ELE Sbjct: 111 ICLLSKKEWI-ELE 123 >SB_44755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 317 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 286 SLKTRMQKTVRARQSAC*RLVASTCFCSTTRNKC 387 S+ TR+Q+T+RA + + S+ CS + KC Sbjct: 220 SVSTRIQRTLRALRPKAAKYAGSSNMCSQVKLKC 253 >SB_14525| Best HMM Match : Phospholip_A2_1 (HMM E-Value=2.2) Length = 462 Score = 27.5 bits (58), Expect = 9.5 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 146 QDREDATR*SVKADRCPGRIFISCTRPQPCDHYWGKTSPLPI 271 +D + AT S K+D I I C + PC H+ + PI Sbjct: 217 KDTKSATICSKKSDITEQTIDIMCVKDNPCGHFVHSDNKSPI 258 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,180,374 Number of Sequences: 59808 Number of extensions: 381595 Number of successful extensions: 867 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -