BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1279 (722 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 134 3e-33 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 26 1.4 AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. 23 7.2 AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. 23 7.2 AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. 23 7.2 AF203333-1|AAF19828.1| 119|Anopheles gambiae immune-responsive ... 23 7.2 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 23 7.2 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 9.6 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 9.6 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 9.6 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 134 bits (323), Expect = 3e-33 Identities = 62/111 (55%), Positives = 76/111 (68%) Frame = +3 Query: 225 DLGSSIKSDKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKHEEKKDQHGYISRQFTRRY 404 D GS++ KDKFQ+NLDVQ F+PEEISVK D ++VEGKHEEK+D HGY+SR F RRY Sbjct: 3 DSGSAVNISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRY 62 Query: 405 ALPEGCTAESVESRLSSDGVLSVIAPRKVPPAVEGERKIPIAQTGPVRKEV 557 LP+G + S LSSDG+L++ PRK ER IPI TG K+V Sbjct: 63 MLPKGHNEADIVSSLSSDGILTITCPRKEIEQKNEERSIPITHTGQPMKQV 113 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 25.8 bits (54), Expect = 1.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 537 RFGRSESCVHPPLLAAPSWVRLQTTHHLKTA 445 +FG CV+ ++ P W R T H+L A Sbjct: 113 QFGEGRECVNCGAISTPLWRRDGTGHYLCNA 143 >AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 Query: 565 WSFTSLRTGPVWAIGILRSP 506 W T PV+ +GI++ P Sbjct: 152 WHLTGFSIDPVYGLGIIKQP 171 >AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 Query: 565 WSFTSLRTGPVWAIGILRSP 506 W T PV+ +GI++ P Sbjct: 152 WHLTGFSIDPVYGLGIIKQP 171 >AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 Query: 565 WSFTSLRTGPVWAIGILRSP 506 W T PV+ +GI++ P Sbjct: 152 WHLTGFSIDPVYGLGIIKQP 171 >AF203333-1|AAF19828.1| 119|Anopheles gambiae immune-responsive alpha-macroglobulinand complement C3-related protein IMCR14 protein. Length = 119 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 Query: 565 WSFTSLRTGPVWAIGILRSP 506 W T PV+ +GI++ P Sbjct: 81 WHLTGFSIDPVYGLGIIKQP 100 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 23.4 bits (48), Expect = 7.2 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 5/83 (6%) Frame = +3 Query: 51 KMSLIPWLFDYEIERPRRLMDQHFGLGLTPEDFLSAAAGPLVSREYYRPWR--HLAAAAR 224 K+ PW E E+P H G + E ++ AA + S R W+ + Sbjct: 115 KIDEFPWTALIEYEKPNGRFGFHCGGSVINERYILTAAHCITS--IPRGWKVHRVRLGEW 172 Query: 225 DLGSSIKSDKDKF---QVNLDVQ 284 DL S+ + D + ++LD++ Sbjct: 173 DLSSTTDQEDDFYADAPIDLDIE 195 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +3 Query: 375 YISRQFTRRYALPEGCTAESVESRLSSDGVLSVIAP 482 Y+S +F +P+GC + L + V +V+ P Sbjct: 661 YLSEEFFCTSGVPQGCVLSPLLFSLFINDVCNVLPP 696 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = -3 Query: 252 CHF*CWSQGLEPRQQGDATGGSILCSQG 169 C CW +G Q+ S CSQG Sbjct: 164 CEVGCWGEGAHNCQRFSKLNCSPQCSQG 191 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.0 bits (47), Expect = 9.6 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 Query: 565 WSFTSLRTGPVWAIGILRSP 506 W T PV+ +GI++ P Sbjct: 659 WYLTGFSIDPVYGLGIIKKP 678 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 748,993 Number of Sequences: 2352 Number of extensions: 16138 Number of successful extensions: 34 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -