BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1277 (737 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 26 0.42 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 26 0.42 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 25 0.98 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 4.0 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 25.8 bits (54), Expect = 0.42 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -1 Query: 635 AYTFLIHSVPRVIVLFRCSQLRPVGSLXLLPDRTRFE 525 +Y+ + V ++ LF Q+ P + L D+TRF+ Sbjct: 77 SYSSVSLQVANLLRLFHIPQISPASTAKALSDKTRFD 113 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 25.8 bits (54), Expect = 0.42 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -1 Query: 635 AYTFLIHSVPRVIVLFRCSQLRPVGSLXLLPDRTRFE 525 +Y+ + V ++ LF Q+ P + L D+TRF+ Sbjct: 167 SYSSVSLQVANLLRLFHIPQISPASTAKALSDKTRFD 203 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 24.6 bits (51), Expect = 0.98 Identities = 20/75 (26%), Positives = 29/75 (38%), Gaps = 9/75 (12%) Frame = +3 Query: 51 KYKNVTAAIHPGIPT*PPSRSGLRAGAYS*RSPDGRHHAN---------DVQRLLPAVEA 203 +++ V A++ P P P S AY+ D H D + LLP V Sbjct: 170 QFQTVVASMDPPEPPVPTVTSACVGSAYTPLKEDHDDHYGVPTLEELGFDTEGLLPPVWV 229 Query: 204 DGDGQ*RRRFHHHLE 248 G+ + R HLE Sbjct: 230 GGESEALARLERHLE 244 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 22.6 bits (46), Expect = 4.0 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = -1 Query: 575 LRPVGSLXLLPDRTRFE*WEQLARSSWQPESWERSRSARRQRTTEDSTVSG 423 LRP + RTR + + L + Q ++W R A T STV G Sbjct: 125 LRPPQEVISHYRRTRRDRYTNLGLVNEQGQTWHDLRVALTSELTAASTVLG 175 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,129 Number of Sequences: 438 Number of extensions: 3705 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -