BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1274 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14952| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 >SB_14952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 419 QYKVSEPCYSGTLIYYYALISHRFAIEYPVS-TKINFKRHY 300 +Y+ S YS T Y Y+L++H F ++Y S +F R Y Sbjct: 210 KYQYSLVTYSFTRKYQYSLVTHSFTMKYQYSLVTYSFTRKY 250 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 419 QYKVSEPCYSGTLIYYYALISHRFAIEYPVS-TKINFKRHY 300 +Y+ S YS T Y Y+L++H F +Y S K +F + Y Sbjct: 366 KYQYSLVTYSFTRKYQYSLVTHSFTRKYQYSLVKYSFTKKY 406 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 419 QYKVSEPCYSGTLIYYYALISHRFAIEYPVS-TKINFKRHY 300 +Y+ S YS T Y Y+L++H F +Y S +F R Y Sbjct: 41 KYQYSLVTYSFTRKYQYSLVTHSFTRKYQYSLVTYSFTRKY 81 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = -3 Query: 419 QYKVSEPCYSGTLIYYYALISHRFA--IEYPVSTKINFKRHY 300 +Y+ S YS T Y Y+L++H F +YP+ T +F R Y Sbjct: 171 KYQYSLVTYSFTRKYQYSLVTHSFTRKYQYPLVT-YSFTRKY 211 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 419 QYKVSEPCYSGTLIYYYALISHRFAIEYPVS-TKINFKRHY 300 +Y+ S YS T Y Y+L++H F +Y S +F R Y Sbjct: 288 KYQYSLVTYSFTKKYQYSLVTHSFTRKYQYSLVTYSFTRKY 328 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 419 QYKVSEPCYSGTLIYYYALISHRFAIEYPVS-TKINFKRHY 300 +Y+ S YS T Y Y+L++H F +Y S +F R Y Sbjct: 327 KYQYSLVTYSFTKKYQYSLVTHSFTRKYQYSLVTYSFTRKY 367 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,160,614 Number of Sequences: 59808 Number of extensions: 364372 Number of successful extensions: 616 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -