BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1273 (386 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0055 + 476204-476388,476481-476543,476684-476800,476920-47... 29 0.97 07_03_1006 + 23260903-23261354,23264532-23264889,23264949-23265575 26 9.1 03_06_0440 - 33954726-33954809,33955141-33955475,33955929-339561... 26 9.1 >06_01_0055 + 476204-476388,476481-476543,476684-476800,476920-477328, 477448-477638,477706-477871 Length = 376 Score = 29.5 bits (63), Expect = 0.97 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 194 SAWVVTTVQPIFYVKQIMYFGLKGCQL*MVVILW 295 S W+V T F++ I+Y G+ GC L V++ W Sbjct: 242 SVWIVRTK---FHILTILYAGVVGCGLSFVLLTW 272 >07_03_1006 + 23260903-23261354,23264532-23264889,23264949-23265575 Length = 478 Score = 26.2 bits (55), Expect = 9.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 250 FWFEGLPVVNGCYPVGGCKNLLRLNGLCMP 339 ++ GLP+V+G Y C L L LC P Sbjct: 310 YYSGGLPIVSGMYASSECFFGLNLRPLCGP 339 >03_06_0440 - 33954726-33954809,33955141-33955475,33955929-33956106, 33956205-33956285,33956629-33956740,33956831-33956931, 33957001-33957174,33957313-33957486,33957683-33957765, 33957852-33957912,33958069-33958251,33959630-33959848 Length = 594 Score = 26.2 bits (55), Expect = 9.1 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 268 PVVNGCYPVGGCKNLLRLNGLC 333 P+V G P+ K LR+ G C Sbjct: 216 PIVPGIMPINNYKGFLRMTGFC 237 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,270,359 Number of Sequences: 37544 Number of extensions: 191899 Number of successful extensions: 421 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 421 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 648814968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -