BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1273 (386 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41390.1 68418.m05029 hypothetical protein contains 1 predict... 27 3.3 At2g42960.1 68415.m05328 protein kinase family protein contains ... 26 7.6 At1g69280.1 68414.m07943 expressed protein 26 7.6 >At5g41390.1 68418.m05029 hypothetical protein contains 1 predicted transmembrane domain; Length = 297 Score = 27.5 bits (58), Expect = 3.3 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 64 IWHQIFLRLVINFNYY*WFSCLCVQCLALIVK 159 +WH + V Y +FSCLC C++ +++ Sbjct: 20 LWHSDLMGTVSADTPYCFFSCLCGPCVSYLLR 51 >At2g42960.1 68415.m05328 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 494 Score = 26.2 bits (55), Expect = 7.6 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 236 KQIMYFGLKGCQL*MVVILWVGV 304 K+I +FGLKG +L + V L VGV Sbjct: 13 KKISFFGLKGLKLWVWVCLVVGV 35 >At1g69280.1 68414.m07943 expressed protein Length = 400 Score = 26.2 bits (55), Expect = 7.6 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 261 RVASCEWLLSCGWV*KPFKTQWSLYAFLVLCCS 359 R SC++ SCGW+ F WS ++ CCS Sbjct: 340 RWPSCDYNSSCGWL---FCCHWSCWS--CCCCS 367 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,621,881 Number of Sequences: 28952 Number of extensions: 167552 Number of successful extensions: 378 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 377 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 547638520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -