BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1271 (606 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|ch... 27 2.1 SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 26 4.9 SPCC1259.14c |meu27||S. pombe specific UPF0300 family protein 5|... 25 8.6 >SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 178 Score = 27.1 bits (57), Expect = 2.1 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 425 SNRNGKKLLLHGRNRRGSGTHSCGL 499 S +NG+ ++LHG N + + +CGL Sbjct: 103 SQKNGELIVLHGINHQAAMLTACGL 127 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 25.8 bits (54), Expect = 4.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 84 YTLPARHYAFVNFNLIFSH-RQFNTCFCFMERLTNRMHPFSCF 209 +T+ A Y F F FSH R+F+ F+ + + PF CF Sbjct: 69 FTIEAFFYWFFFFFFFFSHCRRFHIAI-FIHPYDSNVVPFFCF 110 >SPCC1259.14c |meu27||S. pombe specific UPF0300 family protein 5|Schizosaccharomyces pombe|chr 3|||Manual Length = 736 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 200 KWMHSVCESFHKTETGIELTMGKN*IKIYE 111 +W+H VCE F+ E+ GK +K+ E Sbjct: 593 RWLHIVCEGFNCFLELPEVLHGKKFLKVDE 622 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,574,513 Number of Sequences: 5004 Number of extensions: 53012 Number of successful extensions: 88 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 266270664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -