BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1271 (606 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0790 + 32019972-32020101,32020461-32020657,32020790-320209... 29 3.8 08_02_0405 + 16790720-16791691,16792064-16792135,16794487-167946... 28 6.6 >01_06_0790 + 32019972-32020101,32020461-32020657,32020790-32020993, 32021444-32021645,32021798-32021886,32022567-32022662, 32022710-32022814,32023516-32023556,32023685-32023777, 32023853-32023970,32024488-32024578,32024693-32024766, 32025008-32025187,32025643-32025681 Length = 552 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -1 Query: 282 NKKIKKNSRITIYASFLPVSFLLFKNMKMDAFGL 181 N K + ITIYA LPV LL D FGL Sbjct: 296 NNGSKNDEAITIYAKLLPVLKLLEALWLFDTFGL 329 >08_02_0405 + 16790720-16791691,16792064-16792135,16794487-16794621, 16794630-16794758 Length = 435 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -1 Query: 573 CITASCQK*DK-NAYPCGLTLVGPLVSPHEWVPLP 472 C A+C A PCG +V P P W+ LP Sbjct: 53 CFRAACHHWRSCTASPCGRGVVDPRFHPRRWMMLP 87 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,284,909 Number of Sequences: 37544 Number of extensions: 334012 Number of successful extensions: 592 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 592 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1442939384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -