BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1271 (606 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 prot... 32 0.017 AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A prot... 32 0.017 AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A prot... 32 0.017 AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A prot... 32 0.017 AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A prot... 32 0.017 AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A prot... 32 0.017 AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A prot... 32 0.017 AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 prot... 32 0.017 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 23 5.8 >AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 protein. Length = 153 Score = 31.9 bits (69), Expect = 0.017 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 136 PIVSSIPVSVLWNDSQTEC 192 P+VS P +LWNDSQ +C Sbjct: 51 PVVSKCPPGLLWNDSQKQC 69 >AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 31.9 bits (69), Expect = 0.017 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 136 PIVSSIPVSVLWNDSQTEC 192 P+VS P +LWNDSQ +C Sbjct: 51 PVVSQCPPGLLWNDSQKQC 69 >AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 31.9 bits (69), Expect = 0.017 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 136 PIVSSIPVSVLWNDSQTEC 192 P+VS P +LWNDSQ +C Sbjct: 51 PVVSKCPPGLLWNDSQKQC 69 >AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 31.9 bits (69), Expect = 0.017 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 136 PIVSSIPVSVLWNDSQTEC 192 P+VS P +LWNDSQ +C Sbjct: 51 PVVSKCPPGLLWNDSQKQC 69 >AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 31.9 bits (69), Expect = 0.017 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 136 PIVSSIPVSVLWNDSQTEC 192 P+VS P +LWNDSQ +C Sbjct: 51 PVVSKCPPGLLWNDSQKQC 69 >AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 31.9 bits (69), Expect = 0.017 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 136 PIVSSIPVSVLWNDSQTEC 192 P+VS P +LWNDSQ +C Sbjct: 51 PVVSKCPPGLLWNDSQKQC 69 >AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 31.9 bits (69), Expect = 0.017 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 136 PIVSSIPVSVLWNDSQTEC 192 P+VS P +LWNDSQ +C Sbjct: 51 PVVSKCPPGLLWNDSQKQC 69 >AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 protein. Length = 153 Score = 31.9 bits (69), Expect = 0.017 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 136 PIVSSIPVSVLWNDSQTEC 192 P+VS P +LWNDSQ +C Sbjct: 51 PVVSKCPPGLLWNDSQKQC 69 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.4 bits (48), Expect = 5.8 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -2 Query: 497 VRTSGYHYPAYFCREEVIFFRFGLKGGAAVVTI 399 +RTS HY Y + G GG ++TI Sbjct: 196 IRTSMAHYTFYVAIMWPTIYTLGFTGGTKLLTI 228 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,983 Number of Sequences: 2352 Number of extensions: 13245 Number of successful extensions: 16 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -