BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1264 (672 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 29 0.035 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 4.0 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 29.1 bits (62), Expect = 0.035 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 8/77 (10%) Frame = +2 Query: 326 NTTYLSQETSQDRQTL-YTQLVNSYKWTDKIHEYSSFAHTLLSQN-------SLKRSYIN 481 NT+ L S L Y NS+ WT H +++ +H +QN ++ Y+N Sbjct: 260 NTSSLITTPSPSASPLAYQHEYNSFNWTANGHGHNTSSHNYYAQNYAPTYYGQMQPDYLN 319 Query: 482 SGSTKRRGKLQSNHNVA 532 S +T+ +Q+ +N+A Sbjct: 320 SQTTQNH--MQAMNNMA 334 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 46 FGFQTIL*VFKMNQTINVGAIKFRFKFTTDT 138 FG+QT+L F + + + +K K T T Sbjct: 371 FGYQTLLITFHIGSQLVLHTVKTVLKTTMST 401 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,997 Number of Sequences: 336 Number of extensions: 2657 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -