BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1264 (672 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0572 - 19604643-19604745,19604947-19605629,19605786-196062... 29 2.6 >07_03_0572 - 19604643-19604745,19604947-19605629,19605786-19606284, 19606370-19606878,19607110-19607148,19607347-19607411, 19609081-19609201,19610229-19610315,19611096-19611179, 19611925-19612175,19612869-19612962,19613043-19613284, 19614187-19614505 Length = 1031 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +2 Query: 296 PIPTAPLNLGNTTYLSQETSQDRQTLYTQLVNSYKWTDKIHEYSSFAHTLLSQNSLKR 469 P P + YL ++ + ++ L+ YK ++ S F + L+SQ SLK+ Sbjct: 486 PSPIVVAHAEELRYLIEDITVSMDAIFKNLLEKYKDPSRLCRLSVFNYNLVSQLSLKQ 543 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,493,120 Number of Sequences: 37544 Number of extensions: 255350 Number of successful extensions: 596 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 596 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -