BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1264 (672 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 6.6 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 6.6 AY146727-1|AAO12087.1| 139|Anopheles gambiae odorant-binding pr... 23 6.6 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.4 bits (48), Expect = 6.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 390 TAINGLIRFTNTAPS 434 T +N + RFTN APS Sbjct: 388 TTLNRIARFTNRAPS 402 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.4 bits (48), Expect = 6.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 390 TAINGLIRFTNTAPS 434 T +N + RFTN APS Sbjct: 388 TTLNRIARFTNRAPS 402 >AY146727-1|AAO12087.1| 139|Anopheles gambiae odorant-binding protein AgamOBP20 protein. Length = 139 Score = 23.4 bits (48), Expect = 6.6 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +2 Query: 62 SCRSSK*IKLST*EQLNSALNSLRTLRSSVSHVFETLSNGLRADHGEDGKE 214 SC K I EQ+ + +R++ + V E L NGLR D KE Sbjct: 10 SCTKKKKIFPLRKEQMMKSGEMIRSVCLGKTKVAEELVNGLRESKFADVKE 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 613,753 Number of Sequences: 2352 Number of extensions: 11415 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -