BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1262 (633 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 40 0.001 SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) 39 0.004 SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 38 0.007 SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 38 0.009 SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 38 0.009 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 37 0.012 SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) 37 0.012 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 37 0.016 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 36 0.027 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 36 0.027 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 36 0.027 SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 36 0.036 SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 36 0.036 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 36 0.036 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 36 0.036 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 36 0.036 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.048 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 35 0.048 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.048 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 35 0.048 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 35 0.048 SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.048 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 35 0.048 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.048 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.048 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 35 0.063 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 35 0.063 SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 35 0.063 SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) 35 0.063 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 34 0.083 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 34 0.083 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 34 0.083 SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) 33 0.15 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 33 0.15 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 33 0.15 SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 33 0.19 SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) 33 0.25 SB_42290| Best HMM Match : Band_41 (HMM E-Value=3.6e-09) 33 0.25 SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 32 0.34 SB_5360| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) 32 0.45 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.59 SB_14207| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0048) 31 0.59 SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_12329| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_3322| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_27651| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 1.0 SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 30 1.4 SB_20928| Best HMM Match : NHL (HMM E-Value=0) 30 1.8 SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) 29 2.4 SB_10780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 29 2.4 SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 29 3.1 SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 29 3.1 SB_16819| Best HMM Match : BIR (HMM E-Value=7.5e-30) 29 3.1 SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 29 3.1 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_15354| Best HMM Match : NHL (HMM E-Value=4.4e-14) 29 4.1 SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 29 4.1 SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) 28 5.5 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 28 5.5 SB_45790| Best HMM Match : SERTA (HMM E-Value=2.8e-07) 28 5.5 SB_31352| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) 28 7.2 SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 28 7.2 SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) 28 7.2 SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) 28 7.2 SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) 28 7.2 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 27 9.6 SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +3 Query: 507 CVACLEEILQPCVLQCGHIFCHQCCYGALKTVVH--WCRTPFTK 632 C C +L+P CGH FC C Y +L V CR P TK Sbjct: 330 CKLCFNLLLEPVTSLCGHSFCRDCLYRSLDHRVECPCCRAPLTK 373 >SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) Length = 320 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +3 Query: 486 EVDNEKTCVACLEEILQPCVLQCGHIFCHQCCYG-ALKT-VVHWCRTPFT 629 E+D + C CL++ P L CGH+FC C G AL++ CR P + Sbjct: 64 ELDYQPDCPVCLQQASYPVRLPCGHMFCFLCIKGVALRSRKCAICRQPIS 113 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 37.9 bits (84), Expect = 0.007 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +3 Query: 486 EVDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +V E TC CLE+ +P +L C H FC +C Sbjct: 15 KVREELTCSVCLEQFREPKMLPCFHTFCKEC 45 >SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +3 Query: 477 IPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQCCYG 587 I + E C CLE P VL C H FC++C G Sbjct: 6 IEERLQKEVECPICLERFKDPRVLPCLHTFCYECLVG 42 >SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 858 Score = 37.5 bits (83), Expect = 0.009 Identities = 20/43 (46%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +3 Query: 507 CVACLEEILQPCVLQ-CGHIFCHQCCYGALKT--VVHWCRTPF 626 C CLE I P LQ CGH FC C A K+ + CR PF Sbjct: 678 CPICLETITYPETLQGCGHTFCRPCITEASKSSKLCPTCRDPF 720 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 37.5 bits (83), Expect = 0.009 Identities = 20/43 (46%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +3 Query: 507 CVACLEEILQPCVLQ-CGHIFCHQCCYGALKT--VVHWCRTPF 626 C CLE I P LQ CGH FC C A K+ + CR PF Sbjct: 753 CPICLETITYPETLQGCGHTFCRPCITEASKSSKLCPTCRDPF 795 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 37.1 bits (82), Expect = 0.012 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 471 KEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQCCYGALK 596 K + E+++E +C+ C E ++ L C H FC C L+ Sbjct: 359 KSVVEEMEDEFSCIVCQELFIRATTLTCSHSFCEYCLQSWLR 400 >SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) Length = 203 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +3 Query: 477 IPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQCCYG 587 I + E C CLE P VL C H FC++C G Sbjct: 6 IVERLQKEVECPICLERFKDPRVLPCLHTFCYECLVG 42 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 36.7 bits (81), Expect = 0.016 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 486 EVDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 ++++E TC C+E P +L C H FC C Sbjct: 8 QLEDEVTCAICIEHFTDPRLLPCLHTFCRHC 38 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 35.9 bits (79), Expect = 0.027 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +3 Query: 480 PNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 PN V ++ TC CLE+ P VL C H +C C Sbjct: 18 PNNV-SDVTCSLCLEQYQDPRVLACLHTYCRHC 49 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 35.9 bits (79), Expect = 0.027 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 504 TCVACLEEILQPCVLQCGHIFCHQC 578 +CV C +L PC L CGH C +C Sbjct: 100 SCVRCCGILLGPCTLPCGHTVCEKC 124 Score = 30.7 bits (66), Expect = 1.0 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +3 Query: 498 EKTCVACLEEILQPCVLQCGHIFCHQC 578 E C C P CGH+FC C Sbjct: 376 EFECTLCCRLFYNPVTTPCGHVFCRAC 402 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 35.9 bits (79), Expect = 0.027 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E + P VL C H FC C Sbjct: 9 LEDEVTCSICIEHLNDPRVLPCLHSFCRHC 38 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 35.5 bits (78), Expect = 0.036 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCFHSFCRHC 38 >SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 291 Score = 35.5 bits (78), Expect = 0.036 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCFHSFCRHC 38 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 35.5 bits (78), Expect = 0.036 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCFHSFCRHC 38 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 35.5 bits (78), Expect = 0.036 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCFHSFCRHC 38 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 35.5 bits (78), Expect = 0.036 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 8 LEDEVTCSICIEHFNDPRVLPCFHSFCRHC 37 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 35.5 bits (78), Expect = 0.036 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSLCIEHFNDPRVLPCFHSFCRHC 38 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 35.1 bits (77), Expect = 0.048 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSLCIEHFNDPRVLPCLHSFCRHC 38 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 35.1 bits (77), Expect = 0.048 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCLHSFCRHC 38 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 35.1 bits (77), Expect = 0.048 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSLCIEHFNDPRVLPCLHSFCRHC 38 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 35.1 bits (77), Expect = 0.048 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 129 LEDEVTCSLCIEHFNDPRVLPCLHSFCRHC 158 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 35.1 bits (77), Expect = 0.048 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCLHSFCRHC 38 >SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 35.1 bits (77), Expect = 0.048 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 474 EIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQCCYGALKT 599 E PN + C CL+ + CGH+FC C + L+T Sbjct: 52 EDPNSANANFECNICLDTARDAVISMCGHLFCWPCLHRWLET 93 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 35.1 bits (77), Expect = 0.048 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCLHSFCRHC 38 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.048 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQCCYGALKTVVHW 611 V+++ C C + P V CGH+FC QC +VHW Sbjct: 51 VEDDFKCGICFGVLEDPLVTTCGHVFCSQC-------LVHW 84 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 35.1 bits (77), Expect = 0.048 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 8 LEDEVTCSICIEHFNDPRVLPCLHSFCRHC 37 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 34.7 bits (76), Expect = 0.063 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 + +E TC C+E P VL C H FC C Sbjct: 9 LQDEVTCSICIEHFNDPRVLPCFHSFCRHC 38 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 34.7 bits (76), Expect = 0.063 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 ++ E TC C+E P VL C H FC C Sbjct: 9 LEGEVTCSICIEHFNDPRVLPCLHSFCRHC 38 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 34.7 bits (76), Expect = 0.063 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 504 TCVACLEEILQPCVLQCGHIFCHQC 578 TC CL+ +++P VL C H FC C Sbjct: 36 TCPICLQLLVEPVVLPCEHEFCKMC 60 >SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) Length = 589 Score = 34.7 bits (76), Expect = 0.063 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +3 Query: 450 KKHLDQLKEIPNEVDNEKTCVACLEEILQPCVL-QCGHIFCHQCCYG 587 KK K + +++E +C CLE+ L+P L C H C +C G Sbjct: 4 KKREKAEKTLSGVINDECSCPVCLEDFLEPKSLPNCAHNVCRKCLEG 50 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 34.3 bits (75), Expect = 0.083 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E TC C+E P VL C H FC C Sbjct: 9 LEDEVTCSICIEHFNDPRVLPCFHSFCLHC 38 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 34.3 bits (75), Expect = 0.083 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 480 PNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 P +V ++ TC CLE+ P VL C H +C C Sbjct: 9 PKDV-SDVTCSLCLEQYQDPRVLACLHTYCRHC 40 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 34.3 bits (75), Expect = 0.083 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 480 PNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 P +V ++ TC CLE+ P VL C H +C C Sbjct: 9 PKDV-SDVTCSLCLEQYQDPRVLACLHTYCRHC 40 >SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 549 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +3 Query: 498 EKTCVACLEEILQP-CVLQCGHIFCHQC 578 E TC CLEE+ +P C+ C H C C Sbjct: 14 ELTCPVCLEELKEPKCLTSCAHNVCKPC 41 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 + +E TC C+E P VL C H FC C Sbjct: 14 LQDEVTCSICIEHFDDPRVLPCLHSFCRHC 43 >SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) Length = 623 Score = 33.5 bits (73), Expect = 0.15 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 492 DNEKTCVACLEEILQPCVLQCGHIFCHQCC 581 ++ CV C EEI V +C H C++CC Sbjct: 9 ESSNLCVVCCEEIEFSAVGKCDHPVCYKCC 38 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 33.5 bits (73), Expect = 0.15 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 504 TCVACLEEILQPCVLQCGHIFCHQC 578 TC CLE+ P VL C H +C C Sbjct: 15 TCCLCLEQYQDPRVLACLHTYCRHC 39 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 33.5 bits (73), Expect = 0.15 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 504 TCVACLEEILQPCVLQCGHIFCHQC 578 TC CLE+ P VL C H +C C Sbjct: 15 TCCLCLEQYQDPRVLACLHTYCRHC 39 >SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 33.5 bits (73), Expect = 0.15 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 492 DNEKTCVACLEEILQPCVLQCGHIFCHQCC 581 ++ CV C EEI V +C H C++CC Sbjct: 9 ESSNLCVVCCEEIEFSAVGKCDHPVCYKCC 38 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 489 VDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++E C C+E P VL C H FC C Sbjct: 9 LEDEVRCSICIEHFNDPRVLPCFHSFCRHC 38 >SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) Length = 691 Score = 32.7 bits (71), Expect = 0.25 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +3 Query: 480 PNEVDNEK-TCVACLEEILQPCVLQCGHIFCHQC 578 P E D + TC+ CL+ P +L C H +C +C Sbjct: 6 PQEKDEKDVTCLLCLDIFTDPRLLPCLHTYCKKC 39 >SB_42290| Best HMM Match : Band_41 (HMM E-Value=3.6e-09) Length = 474 Score = 32.7 bits (71), Expect = 0.25 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 495 NEKTCVACLEEILQPCVLQCGHIFCHQCC 581 N+ TC C++ + CGH++C Q C Sbjct: 402 NDLTCQICMDAEVNTAFCPCGHVYCCQTC 430 >SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 32.7 bits (71), Expect = 0.25 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +3 Query: 465 QLKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 Q+ I + + E C C + +P +L+C H FC++C Sbjct: 84 QMASILDSLRQEAECSLCHKTPSEPKILKCFHTFCNEC 121 >SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 32.7 bits (71), Expect = 0.25 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 468 LKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 L+ + V +E C C + L P V CGH+ C +C Sbjct: 5 LEYFDDPVPSEFLCSYCRKVYLHPLVTGCGHVLCTKC 41 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 32.3 bits (70), Expect = 0.34 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +3 Query: 507 CVACLEEILQPCVLQCGHIFCHQC 578 C C E + +P +L+C H++C +C Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKC 37 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 32.3 bits (70), Expect = 0.34 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +3 Query: 459 LDQLKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 ++QL ++ + +E+ C CL+ + P + +C H+FC C Sbjct: 50 INQLLQVLSSGVSEE-CPICLDPLDDPSITRCAHVFCTGC 88 >SB_5360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 32.3 bits (70), Expect = 0.34 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 3/88 (3%) Frame = +3 Query: 126 TFGENLTRRFVNHVGKKIETNRSLRSEAQDLFLIAVKTLGDVLPQIQSIHRAL---SYIC 296 +F ENL R + K + S+ + AQ++F A D++ ++ + S +C Sbjct: 48 SFIENLVSRTIKSGFKALYGKNSVGA-AQEMFCKATLDATDIIDPMKKSDLIITDSSMMC 106 Query: 297 GGPLQIGKNLTGIDYVHVRPAATASYAH 380 G L N+T +DY + P+ + Y + Sbjct: 107 GAVLAEYLNITRVDYCSIAPSLSTMYQY 134 >SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) Length = 1631 Score = 31.9 bits (69), Expect = 0.45 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 498 EKTCVACLEEILQPCVL-QCGHIFCHQCCYGALK 596 E +C CLE +P VL CGH C QC K Sbjct: 20 EISCPVCLEVFEEPLVLPSCGHSVCLQCLQNMTK 53 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 31.5 bits (68), Expect = 0.59 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 480 PNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 P +V ++ TC CL + P VL C H +C C Sbjct: 9 PKDV-SDVTCSLCLGQYQDPRVLACLHTYCRHC 40 >SB_14207| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0048) Length = 233 Score = 31.5 bits (68), Expect = 0.59 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +3 Query: 486 EVDNEKTCVACLEEILQPCVLQCGHIFCHQCCYGALKTVVH---WCRTPFTK 632 +V+ CV C + +L P +C H C C + K V +CRT K Sbjct: 98 KVEELFACVCCQDLVLYPVTTKCLHNICKGCLQRSFKAEVFTCPYCRTDLGK 149 >SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 31.1 bits (67), Expect = 0.78 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 495 NEKTCVACLEEILQPCVLQCGHIFCHQC 578 +E C CL+E +P L C H C +C Sbjct: 17 DELLCPICLDEFKEPKTLSCMHDLCRKC 44 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 30.7 bits (66), Expect = 1.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 507 CVACLEEILQPCVLQCGHIFCHQC 578 C CL E P +L+C H FC +C Sbjct: 20 CPVCLGEYKNPMLLRCYHSFCLRC 43 >SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 585 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 477 IPNEVDNEKT-CVACLEEILQPCVLQCGHIF-CHQC 578 IP+ +N+ T CV CLE +L CGH+ C C Sbjct: 527 IPDMDENQGTQCVICLENQRNVVLLNCGHVCSCRTC 562 >SB_12329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 30.7 bits (66), Expect = 1.0 Identities = 10/38 (26%), Positives = 23/38 (60%) Frame = +3 Query: 468 LKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQCC 581 L+E +++++ C C++E + ++ CGH+ C + C Sbjct: 133 LQEKLSKLEDGLRCKVCMDEQINAVLIPCGHMVCCEQC 170 >SB_3322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 777 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = +3 Query: 483 NEVDNEKT---CVACLEEILQPCVLQCGHI-FCHQCCYGAL 593 NEVD++ CV C+ + +L C H+ C C + AL Sbjct: 238 NEVDDDDNVLECVICMSDFRDTLILPCRHLCLCKACAFHAL 278 >SB_27651| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 280 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 396 SLVNLNEHMK-QLQQV*HEHNQCQSDFYLSVKVLRRCKIMPCE 271 S + L +HM +++ H+ NQC +FY + R +I CE Sbjct: 15 SAIGLKQHMTFHVEKKSHKCNQCDMEFYTRGDLTRHLRIHSCE 57 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 492 DNEKTCVACLEEILQPCVLQ-CGHIFCHQC 578 ++++ C AC E+ P L CGH++C C Sbjct: 1946 EDQELCPACFCEVDNPYQLATCGHVYCRGC 1975 >SB_20928| Best HMM Match : NHL (HMM E-Value=0) Length = 795 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 501 KTCVACLEEILQPCVLQCGHIFCHQC 578 + C C+ P VL C H FC QC Sbjct: 13 EVCPKCMNAYENPKVLPCLHTFCSQC 38 >SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 29.9 bits (64), Expect = 1.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 507 CVACLEEILQPCVLQCGHIFCHQC 578 C AC + +P +L C H FC +C Sbjct: 16 CRACHKVFTEPKILDCLHTFCQKC 39 >SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) Length = 321 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 483 NEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 NE + C+ C + P V +C H FC C Sbjct: 237 NEDNLPFACIMCRKTFKNPVVTKCLHYFCEAC 268 >SB_10780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +3 Query: 465 QLKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFC 569 Q E P N++ C C+ + + CGH FC Sbjct: 86 QAPEPPRAFSNDRQCPVCITDARFLTMTNCGHEFC 120 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 5/49 (10%) Frame = +3 Query: 501 KTCVACLEEILQPC---VLQCGHIFCHQCCYGALK--TVVHWCRTPFTK 632 K+C CLEE +L CGH +C C L+ T CR P ++ Sbjct: 260 KSCPICLEEFTPETPTRLLVCGHKYCEPCLSRWLENNTTCPICRKPTSR 308 >SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +3 Query: 507 CVACLEEILQPCVLQCGHIFCHQC 578 C C E + QP C H FC C Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLC 183 >SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 262 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +3 Query: 507 CVACLEEILQPCVLQCGHIFCHQC 578 C C E + QP C H FC C Sbjct: 34 CAICKEVLTQPIATPCDHYFCVLC 57 >SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +3 Query: 507 CVACLEEILQPCVLQCGHIFCHQC 578 C C E + QP C H FC C Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLC 183 >SB_16819| Best HMM Match : BIR (HMM E-Value=7.5e-30) Length = 514 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/54 (24%), Positives = 25/54 (46%) Frame = +3 Query: 462 DQLKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQCCYGALKTVVHWCRTP 623 + L++ + E+ C C++ + L CGH+ C C ++ + CR P Sbjct: 458 ESLQQKLERMQEERLCKICMDAEVGIVFLPCGHLSCCPGCAEGME-LCPMCRAP 510 >SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +3 Query: 507 CVACLEEILQPCVLQCGHIFCHQC 578 C C E + QP C H FC C Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLC 183 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 29.1 bits (62), Expect = 3.1 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +3 Query: 507 CVACLEEILQPCVLQCGHIFCHQC 578 C C P + CGH FC C Sbjct: 194 CPLCRRVFKDPVITSCGHTFCQAC 217 >SB_15354| Best HMM Match : NHL (HMM E-Value=4.4e-14) Length = 1071 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 504 TCVACLEEILQPCVLQCGHIFCHQCC 581 TC +C E + P +L C C CC Sbjct: 118 TCPSCKETMNDPVLLPCLDSICRSCC 143 >SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 306 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +3 Query: 468 LKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 +++ +VD C C E + + + CGH FC C Sbjct: 5 VQQFIEKVDPNLLCGICAEVLERAVLTPCGHSFCGVC 41 >SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) Length = 1712 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +3 Query: 504 TCVACLEEILQPCVLQ---CGHIFCHQCCYGALK 596 TC CLE+ +L CG +FC QC LK Sbjct: 781 TCSLCLEDRTNAMLLTHDGCGRMFCRQCLGVMLK 814 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 507 CVACLEEILQPCVLQCGHIFCHQCCYG-ALKT 599 C C + +P +L C H FC C G A KT Sbjct: 62 CRVCNQRFNKPKLLHCLHSFCQSCIEGLARKT 93 >SB_45790| Best HMM Match : SERTA (HMM E-Value=2.8e-07) Length = 1213 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -1 Query: 606 AQLF*VRHSNIDGRIYGHTEEHKVVIFPPSMQHMSFRY 493 A LF +R ++ R+ GHTE V F P+ + RY Sbjct: 237 AYLFDIRGTSFSHRLTGHTEVVSDVAFHPARPEVLLRY 274 >SB_31352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/56 (25%), Positives = 26/56 (46%) Frame = +3 Query: 462 DQLKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQCCYGALKTVVHWCRTPFT 629 ++LK++ + + + C C++ + CGH+ C C AL CR+ T Sbjct: 337 EELKKMVWHLQDARICQICMDVEVATAFCPCGHVVCCVEC-SALCKECPLCRSQIT 391 >SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) Length = 379 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 504 TCVACLEEILQPCVLQCGHIFCHQCC 581 TC +C E + P +L C C CC Sbjct: 26 TCPSCKETMNGPVLLPCLDSICRSCC 51 >SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 346 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/37 (27%), Positives = 15/37 (40%) Frame = +3 Query: 468 LKEIPNEVDNEKTCVACLEEILQPCVLQCGHIFCHQC 578 L + ++D C C+ + CGH FC C Sbjct: 5 LNKFVGKIDQNLLCNICVGVLENAITTICGHSFCESC 41 >SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) Length = 605 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 504 TCVACLEEILQPCVLQCGHIFCHQCC 581 TC +C E + P +L C C CC Sbjct: 26 TCPSCKETMNGPVLLPCLDSICRSCC 51 >SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) Length = 1033 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 582 SNIDGRIYGHTEEHKVVIFPPSMQHMSFRYPLH 484 +N D I+G EEH PP++ ++ YP H Sbjct: 974 NNDDSEIWGVLEEHYPHNDPPTLTPATYLYPYH 1006 >SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1257 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/27 (37%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +3 Query: 507 CVACLEEILQPCVLQ-CGHIFCHQCCY 584 C C + P L CG++FC+ C Y Sbjct: 1201 CPLCAKVRTNPTALSTCGYVFCYPCIY 1227 >SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) Length = 2065 Score = 27.9 bits (59), Expect = 7.2 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 6 FTTLKDLQTLGEEYSGIVQVDDSYHKLPSYYARLASVLLS 125 F TL+DL E YS V D +H + A+ +LLS Sbjct: 1083 FITLRDLFRWAERYSKTPDVGDGFHDWEHHLAQDGYMLLS 1122 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 27.5 bits (58), Expect = 9.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 507 CVACLEEILQPCVLQCGHIFCHQC 578 C C E P +L C H FC +C Sbjct: 145 CPLCHEMFANPRLLPCLHTFCKRC 168 >SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 507 CVACLEEILQPCVLQCGHIFCHQC 578 C C E P VL C H FC C Sbjct: 17 CGICQETYNNPKVLPCLHSFCQNC 40 >SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 27.5 bits (58), Expect = 9.6 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = +3 Query: 411 HAFVCCGQSVYLAKKHLDQ-----LKEIPNEVDNEKTCVACLEEILQP 539 HAF C G Y KHL+ ++ I N VD+ C+ L P Sbjct: 802 HAFYCTGVCPYPIAKHLNATNHAIVQTIMNTVDSNVPNACCIPTTLNP 849 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,239,635 Number of Sequences: 59808 Number of extensions: 374580 Number of successful extensions: 1084 Number of sequences better than 10.0: 84 Number of HSP's better than 10.0 without gapping: 1014 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1084 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -