BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1258 (620 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 24 1.2 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 22 4.8 AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 21 6.3 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 6.3 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 6.3 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 21 6.3 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 324 RRACGHAPSRRDEPASHVQQPLGS 253 +RA S RDE +HVQ LG+ Sbjct: 63 KRAITQQHSERDERLAHVQAQLGA 86 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/21 (47%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 470 EASKLFDDG-DEPWQKQLESV 411 E S L+ G D PWQ++ E+V Sbjct: 216 ENSPLYWGGADTPWQREYENV 236 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 21.4 bits (43), Expect = 6.3 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +3 Query: 51 QNTEYCNYRSPLSTRYASKEMQYNFSDQKKFSTWRKLWIYLAKAEKELGL 200 Q+ ++ + L R ++ ++YN + K F K +AK+EKE L Sbjct: 74 QSLQFRLLENKLGVRQENR-VKYNQNYSKVFGNDEKALEQIAKSEKEPSL 122 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 6.3 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +3 Query: 51 QNTEYCNYRSPLSTRYASKEMQYNFSDQKKFSTWRKLWIYLAKAEKELGL 200 Q+ ++ + L R ++ ++YN + K F K +AK+EKE L Sbjct: 134 QSLQFRLLENKLGVRQENR-VKYNQNYSKVFGNDEKALEQIAKSEKEPSL 182 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 6.3 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +3 Query: 51 QNTEYCNYRSPLSTRYASKEMQYNFSDQKKFSTWRKLWIYLAKAEKELGL 200 Q+ ++ + L R ++ ++YN + K F K +AK+EKE L Sbjct: 134 QSLQFRLLENKLGVRQENR-VKYNQNYSKVFGNDEKALEQIAKSEKEPSL 182 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -3 Query: 123 NCTAFLWRHI 94 N TAFLW HI Sbjct: 165 NKTAFLWYHI 174 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,315 Number of Sequences: 336 Number of extensions: 2997 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15875032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -