BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1258 (620 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 4.5 CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 23 5.9 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 23 7.8 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 4.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 316 RSARGVPSPRPSYTW 360 RS +GV PR ++TW Sbjct: 90 RSPKGVDMPRTTFTW 104 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 23.4 bits (48), Expect = 5.9 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = +3 Query: 504 FTHLQPAQL---TTVGKRASLWLNDLLMDERALSR 599 FT QP Q+ TT S+WL +L E +L R Sbjct: 16 FTGRQPWQIVAITTTTVLGSIWLCQVLFQEESLYR 50 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 335 PRRAHHTPGSHLVLRRRQ 388 P+R HHT S+L+ R+ Sbjct: 253 PKRYHHTVASNLIFALRE 270 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 629,785 Number of Sequences: 2352 Number of extensions: 12374 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -