BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1256 (626 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC776.08c |||Nrap|Schizosaccharomyces pombe|chr 2|||Manual 28 0.96 SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces ... 28 1.3 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 26 5.1 SPAC1556.01c |rad50|SPAP4C9.01c|DNA repair protein Rad50|Schizos... 25 6.8 SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizos... 25 9.0 >SPBC776.08c |||Nrap|Schizosaccharomyces pombe|chr 2|||Manual Length = 1097 Score = 28.3 bits (60), Expect = 0.96 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -3 Query: 555 ICRLPLKKSVCTSFEESISLECSLMKL-STAVLASPSSFLFL 433 +C++ L S+CTS + SL+ L KL S +L +P + L L Sbjct: 501 VCQIILYSSICTSCSINESLKTKLPKLISFGLLLNPDALLRL 542 >SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 817 Score = 27.9 bits (59), Expect = 1.3 Identities = 32/125 (25%), Positives = 55/125 (44%), Gaps = 7/125 (5%) Frame = +2 Query: 170 EYKLEGDVVKVKNVHIIDGVKKYIE---GTAKL-TDDANKAAKLTVTFKFGE--ISRDGS 331 EY++EG +++ N IID + E G KL KA + T+T E + + Sbjct: 600 EYRMEGQFLEIYNETIIDLLASGNEEEKGKKKLEIYHDTKAGRTTITNITSEPLDTPEQV 659 Query: 332 VQILATDYNNYAIAYNCKYDDKKKSHQVFVWILSRNKKLEGDAKTAVDNFIK-EHSKEID 508 +L N ++A + +SH VF+ L+ + G+ + N I S+ + Sbjct: 660 TWLLDQASKNRSVAATNANEHSSRSHSVFMLHLNGSNSTTGETCRSTLNLIDLAGSERLS 719 Query: 509 SSKLV 523 SS+ V Sbjct: 720 SSQSV 724 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 25.8 bits (54), Expect = 5.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 443 KLEGDAKTAVDNFIKEHSKEIDSSK 517 K+EGDAKT DN +++ K D K Sbjct: 1306 KIEGDAKTGDDNEMEDLDKMEDLEK 1330 >SPAC1556.01c |rad50|SPAP4C9.01c|DNA repair protein Rad50|Schizosaccharomyces pombe|chr 1|||Manual Length = 1290 Score = 25.4 bits (53), Expect = 6.8 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +2 Query: 80 NFNLTAYQGIWYEISKFPNESEKNGKCSSAEYKLEGDVVKVKNVHIIDGVKKY 238 N N +GI E+SK+ + KN + SS + K V+ + I+G+K + Sbjct: 376 NINEINEEGIMTEVSKYASLVNKNYEISSGKLKERQVAVRAR----IEGIKAH 424 >SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 25.0 bits (52), Expect = 9.0 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 402 SPIKCSSGSSL-ETRSLKATLKLLSIISSRSTPKR*TLRNLCIPIFS 539 +P K ++ + L E +SLK T K LS ISS S K N P+FS Sbjct: 150 NPQKGNNNNLLKENKSLKTTAKDLSDISSSSMKK---ANNSSKPLFS 193 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,338,888 Number of Sequences: 5004 Number of extensions: 45224 Number of successful extensions: 134 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -