BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1256 (626 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58070.1 68418.m07267 lipocalin, putative similar to temperat... 56 1e-08 At5g37190.1 68418.m04465 COP1-interacting protein 4 (CIP4) simil... 31 0.63 At4g00930.1 68417.m00126 COP1-interacting protein 4.1 (CIP4.1) i... 30 1.1 At1g08550.1 68414.m00948 violaxanthin de-epoxidase precursor, pu... 29 1.9 At5g60040.1 68418.m07529 DNA-directed RNA polymerase, putative s... 29 3.3 At2g27110.2 68415.m03258 far-red impaired responsive protein, pu... 29 3.3 At2g27110.1 68415.m03257 far-red impaired responsive protein, pu... 29 3.3 At1g21630.1 68414.m02708 calcium-binding EF hand family protein ... 29 3.3 At5g36740.1 68418.m04402 PHD finger family protein 28 4.4 At5g36670.1 68418.m04388 PHD finger family protein 28 4.4 At5g17000.1 68418.m01991 NADP-dependent oxidoreductase, putative... 28 4.4 At2g33435.1 68415.m04098 RNA recognition motif (RRM)-containing ... 27 7.7 At2g29070.2 68415.m03533 ubiquitin fusion degradation UFD1 famil... 27 7.7 At2g29070.1 68415.m03534 ubiquitin fusion degradation UFD1 famil... 27 7.7 >At5g58070.1 68418.m07267 lipocalin, putative similar to temperature stress-induced lipocalin [Triticum aestivum] GI:18650668 Length = 186 Score = 56.4 bits (130), Expect = 1e-08 Identities = 43/146 (29%), Positives = 71/146 (48%), Gaps = 3/146 (2%) Frame = +2 Query: 62 ELKPVNNFNLTAYQGIWYEISKFPNESE-KNGKCSSAEYKLEGD-VVKVKNVHIIDGVKK 235 E++ V N+ Y G WYEI+ FP+ + KNG + A Y L D + V N +G + Sbjct: 6 EMEVVKGLNVERYMGRWYEIASFPSRFQPKNGVDTRATYTLNPDGTIHVLNETWSNGKRG 65 Query: 236 YIEGTAKLTDDANKAAKLTVTFKFGEISRDGSVQILATDYNNYAIAYNCKYDDKKKSHQV 415 +IEG+A D + AKL V F + + DY I + ++ + + Sbjct: 66 FIEGSAYKADPKSDEAKLKVKFYVPPFL---PIIPVTGDYWVLYIDPDYQHALIGQPSRS 122 Query: 416 FVWILSRNKKLEGDA-KTAVDNFIKE 490 ++WILSR ++E + K V+ ++E Sbjct: 123 YLWILSRTAQMEEETYKQLVEKAVEE 148 >At5g37190.1 68418.m04465 COP1-interacting protein 4 (CIP4) similar to COP1-interacting protein 4 (CIP4) [Arabidopsis thaliana] GI:13160646; supporting cDNA gi|13160645|dbj|AB036832.1|; Length = 876 Score = 31.1 bits (67), Expect = 0.63 Identities = 20/75 (26%), Positives = 36/75 (48%) Frame = +2 Query: 143 EKNGKCSSAEYKLEGDVVKVKNVHIIDGVKKYIEGTAKLTDDANKAAKLTVTFKFGEISR 322 EK+GK SS K + + V+ ++D +++ E L K++K T K ++ Sbjct: 515 EKSGKKSSKRSKKKDSLNIVEEAQVVDSLQQKKEAEENLEKSGKKSSKKTK--KKDSLNI 572 Query: 323 DGSVQILATDYNNYA 367 Q+L+ + NN A Sbjct: 573 VEEAQVLSVEVNNVA 587 >At4g00930.1 68417.m00126 COP1-interacting protein 4.1 (CIP4.1) identical to cDNA CIP4.1 mRNA for COP1-interacting protein 4.1, GI:13160649 Length = 976 Score = 30.3 bits (65), Expect = 1.1 Identities = 25/130 (19%), Positives = 57/130 (43%) Frame = +2 Query: 143 EKNGKCSSAEYKLEGDVVKVKNVHIIDGVKKYIEGTAKLTDDANKAAKLTVTFKFGEISR 322 EK+GK SS K + + V+ ++D +++ E L K++K + K ++ Sbjct: 665 EKSGKKSSKRSKKKDSLNIVEEAQVVDSLQQKKEAEENLEKSGKKSSKRSK--KKDSLNI 722 Query: 323 DGSVQILATDYNNYAIAYNCKYDDKKKSHQVFVWILSRNKKLEGDAKTAVDNFIKEHSKE 502 Q+L+ + NN A ++ K + +F + K ++ + +++++ Sbjct: 723 VEEAQVLSVEVNNVAQEEASPINNPKDTDALFTPAKKNTESNASPLKKIIE--VTDNTED 780 Query: 503 IDSSKLVHTD 532 I+ S V + Sbjct: 781 INRSMQVQKE 790 >At1g08550.1 68414.m00948 violaxanthin de-epoxidase precursor, putative (AVDE1) similar to EST gb|N37612 Length = 462 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 74 VNNFNLTAYQGIWYEISKFPNESEKNGKCSSAEYKLEGDVVKVKNV 211 V NFN++ + G WY I+ N + C E+ EGD V N+ Sbjct: 204 VQNFNISDFNGKWY-ITSGLNPTFDAFDCQLHEFHTEGDNKLVGNI 248 >At5g60040.1 68418.m07529 DNA-directed RNA polymerase, putative similar to SP|P04051 DNA-directed RNA polymerase III largest subunit (EC 2.7.7.6) {Saccharomyces cerevisiae}; contains InterPro accession IPR000722: RNA polymerase, alpha subunit Length = 1328 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 236 YIEGTAKLTDDANKAAKLTVTFKFGEISRDGSVQILATDYNNYAIA 373 Y + ++ KA F G ++DG IL DYN++A A Sbjct: 609 YFRNSELISGQLGKATLALDIFPLGNGNKDGLYSILLRDYNSHAAA 654 >At2g27110.2 68415.m03258 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 28.7 bits (61), Expect = 3.3 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 443 KLEGDAKTAVDNFIKEHSKEIDSSKLVH 526 +L+G K V F+KEH+ + SS ++H Sbjct: 115 ELQGHEKWVVTKFVKEHTHGLASSNMLH 142 >At2g27110.1 68415.m03257 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 28.7 bits (61), Expect = 3.3 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 443 KLEGDAKTAVDNFIKEHSKEIDSSKLVH 526 +L+G K V F+KEH+ + SS ++H Sbjct: 115 ELQGHEKWVVTKFVKEHTHGLASSNMLH 142 >At1g21630.1 68414.m02708 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain; ESTs gb|T44428 and gb|AA395440 come from this gene Length = 1218 Score = 28.7 bits (61), Expect = 3.3 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Frame = +2 Query: 431 SRNKKLEGDAKTAVDNFIKEHSKEIDSSKLVHTDFFRGSLQ---IYQLQRDN 577 S N K E TAVD + E KEI SK DFFR +Q +Y+ + DN Sbjct: 593 SLNTKFE--EATAVDKKVDELEKEIADSK-QKIDFFRAKMQELVLYKSRCDN 641 >At5g36740.1 68418.m04402 PHD finger family protein Length = 1179 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 158 CSSAEYKLEGDVVKVKNVHIIDGVKKYIEGTAKLTD 265 C Y EGD + N+ ++DG + E T KLTD Sbjct: 1020 CLKLTYVEEGDNDRESNLKLLDGSVEEKEDTKKLTD 1055 >At5g36670.1 68418.m04388 PHD finger family protein Length = 1193 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 158 CSSAEYKLEGDVVKVKNVHIIDGVKKYIEGTAKLTD 265 C Y EGD + N+ ++DG + E T KLTD Sbjct: 1034 CLKLTYVEEGDNDRESNLKLLDGSVEEKEDTKKLTD 1069 >At5g17000.1 68418.m01991 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 345 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Frame = +2 Query: 119 ISKFPNESEKNGKCSSAEYKLEG--DVVKVKNVHI 217 +S FP ES+ + K ++ E+KL G + V VKN+++ Sbjct: 14 VSGFPKESDFDFKTTTVEFKLPGGSNSVLVKNLYL 48 >At2g33435.1 68415.m04098 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 979 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 431 SRNKKLEGDAKTAVDNFIKEHSKE 502 +R +K EG+ TA I+EHSK+ Sbjct: 548 NRKRKAEGECSTAETESIEEHSKD 571 >At2g29070.2 68415.m03533 ubiquitin fusion degradation UFD1 family protein similar to SP|P70362 Ubiquitin fusion degradation protein 1 homolog (UB fusion protein 1) {Mus musculus}; contains Pfam profile PF03152: Ubiquitin fusion degradation protein UFD1 Length = 312 Score = 27.5 bits (58), Expect = 7.7 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = +2 Query: 182 EGDVVKVKNVHIIDGVK-KYIEGTAKLTDDANKAAKLTVTFKFGEISRDGSVQILATDYN 358 EGDV++VKN+ ++ G K T D +N A L T + G + YN Sbjct: 91 EGDVMQVKNISLVKGTYIKLQPHTQDFLDISNPKAILETTLRSYSCLTTGDT--IMVPYN 148 Query: 359 N 361 N Sbjct: 149 N 149 >At2g29070.1 68415.m03534 ubiquitin fusion degradation UFD1 family protein similar to SP|P70362 Ubiquitin fusion degradation protein 1 homolog (UB fusion protein 1) {Mus musculus}; contains Pfam profile PF03152: Ubiquitin fusion degradation protein UFD1 Length = 280 Score = 27.5 bits (58), Expect = 7.7 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = +2 Query: 182 EGDVVKVKNVHIIDGVK-KYIEGTAKLTDDANKAAKLTVTFKFGEISRDGSVQILATDYN 358 EGDV++VKN+ ++ G K T D +N A L T + G + YN Sbjct: 59 EGDVMQVKNISLVKGTYIKLQPHTQDFLDISNPKAILETTLRSYSCLTTGDT--IMVPYN 116 Query: 359 N 361 N Sbjct: 117 N 117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,226,310 Number of Sequences: 28952 Number of extensions: 235728 Number of successful extensions: 774 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -