BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1254 (719 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0463 - 3666626-3666933,3667060-3667258,3667388-3667629,366... 29 4.9 01_05_0274 - 20293963-20294065,20294501-20294560,20295006-202950... 29 4.9 >05_01_0463 - 3666626-3666933,3667060-3667258,3667388-3667629, 3667823-3669035 Length = 653 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 128 NCKYDDKKKSHQVFVWILSRNKKLEGDAKTAVDN 229 +CK D H + + N+ LEGD ++ +DN Sbjct: 556 SCKQDTSDDDHAAYFPVQVANELLEGDVRSLLDN 589 >01_05_0274 - 20293963-20294065,20294501-20294560,20295006-20295052, 20296065-20296155,20296276-20296427,20296891-20297049, 20297132-20297381,20298255-20298317,20298394-20298566 Length = 365 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -1 Query: 476 ISVIGW-LWSLQSGSTNKTKPYANLNTVVTIQFDSPQCFKYLFSLNVFRVRLSRW 315 +S W LW++ G + P LNT + I F + QCF +L + R SRW Sbjct: 150 LSTTCWALWTVLQGPMLEVYPSKLLNTTIQIVFATIQCF--FIALAIER-DFSRW 201 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,032,297 Number of Sequences: 37544 Number of extensions: 308712 Number of successful extensions: 778 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -