BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1249 (360 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. 23 2.6 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 3.5 >AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. Length = 100 Score = 23.4 bits (48), Expect = 2.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 303 FSTVHGNGPNCVLTQMLGYLKYEAGRSILHL 211 +S GN NC+ ++G + E LHL Sbjct: 70 YSKTTGNSGNCIACAIIGVAREEYFAERLHL 100 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.0 bits (47), Expect = 3.5 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -3 Query: 328 YGLPTGLSLQYRPWQWSELCSHPNVGLPQVRGGEIDFA 215 YGLP LS+ + LC+ + +R G I F+ Sbjct: 182 YGLPDSLSVMNGEDESRALCTSEYSDISPLRDGNIAFS 219 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.316 0.133 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 365,885 Number of Sequences: 2352 Number of extensions: 6692 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 26654730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -