BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1218 (613 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 4.1 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 5.4 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 5.4 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 5.4 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 21 7.2 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.5 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.2 bits (45), Expect = 4.1 Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +1 Query: 106 CAFRYLIALVKHQIAFVTYYLLIFCGPKKMSASSATFVID-ASSFSTGPVRDTQ 264 C F+ + H+++ +YL ++ + S T V+ A F + P DTQ Sbjct: 92 CFFKNAKKVTFHEMSIPNHYLWLYHDKTLLYMSKLTLVLSCAMKFESYP-HDTQ 144 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 512 TSLFAVAVHEFGHSLGLSHSSVKGAL 589 T L + + +FG L SH S + AL Sbjct: 521 TKLSKIILMQFGDKLESSHDSFQAAL 546 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 512 TSLFAVAVHEFGHSLGLSHSSVKGAL 589 T L + + +FG L SH S + AL Sbjct: 559 TKLSKIILMQFGDKLESSHDSFQAAL 584 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 5.4 Identities = 13/46 (28%), Positives = 17/46 (36%) Frame = -3 Query: 500 RHLWALTTRVRHHQSARHHRGPRQERKRELESYLVHRIDMHRHGNV 363 R LW +VR RQER R + MH + +V Sbjct: 578 RALWPTEWKVRPSTVEEREEFRRQERMRYAAPHKAFTYRMHGYASV 623 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.4 bits (43), Expect = 7.2 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 5/46 (10%) Frame = +3 Query: 273 HAPSTFGNK-----PPDLLSQK*IRKRPISLSRSPNVTMTMHIYSM 395 H+ ST +K DLLS + +R S++ + VT+T+ + +M Sbjct: 215 HSESTIDSKFGLGFTTDLLSYNILLRRHYSMNSTTYVTLTIVLMTM 260 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.0 bits (42), Expect = 9.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 197 VPALQRLSSTRRPSLLDPYETR 262 V + R+ STRRPS + E++ Sbjct: 392 VSGINRVGSTRRPSRRNSCESQ 413 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 9.5 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -3 Query: 305 GRLVPKRRGRVPT 267 GR VP+R RVPT Sbjct: 1362 GRPVPERPERVPT 1374 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,019 Number of Sequences: 438 Number of extensions: 3945 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -