BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1210 (353 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0571 - 19602755-19603831 49 9e-07 10_05_0025 + 8215685-8215716,8215859-8215937,8216340-8216412,821... 44 3e-05 03_05_0223 - 22087076-22087340,22087448-22087726,22087808-220879... 27 4.2 04_01_0260 - 3506672-3508981 26 7.4 04_01_0254 + 3388215-3388553,3388869-3390830 26 7.4 03_02_0846 + 11712530-11712740,11713974-11714055,11714127-117142... 26 7.4 09_02_0365 + 7910800-7910874,7911735-7911842,7911957-7912046,791... 26 9.8 05_06_0049 + 25182075-25182332,25182624-25182882,25182986-251832... 26 9.8 05_01_0542 + 4729099-4729419,4730837-4731086,4731387-4731751 26 9.8 02_04_0447 + 22998353-22999033,22999665-22999831,22999965-23000622 26 9.8 >07_03_0571 - 19602755-19603831 Length = 358 Score = 49.2 bits (112), Expect = 9e-07 Identities = 24/62 (38%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Frame = +2 Query: 134 TLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQ-FYERAEVTPP 310 +L+ + R+ SV+N QKIT++MK+V+AAK RA+ + ++RP+ E V+ Y + Sbjct: 37 SLRELRSRIDSVRNTQKITEAMKLVAAAKVRRAQEAVVSSRPFSEALVEVLYNMNQEIQT 96 Query: 311 ED 316 ED Sbjct: 97 ED 98 >10_05_0025 + 8215685-8215716,8215859-8215937,8216340-8216412, 8216712-8216864,8217456-8217569,8217649-8217776, 8219004-8219099,8219479-8219601,8219694-8219810, 8219983-8220104,8220439-8220508 Length = 368 Score = 44.0 bits (99), Expect = 3e-05 Identities = 27/71 (38%), Positives = 41/71 (57%) Frame = +2 Query: 140 KAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQFYERAEVTPPEDD 319 +A+ R+KSV+NIQKIT++MKMV+A+K + + +R + F P D Sbjct: 60 RALRTRMKSVRNIQKITKAMKMVAASKLRAVQIRTENSRGLWQ---PFTALLGDVPSVDV 116 Query: 320 PKQLFVAMTSD 352 K + VA+TSD Sbjct: 117 KKNVIVAITSD 127 >03_05_0223 - 22087076-22087340,22087448-22087726,22087808-22087950, 22088029-22088133,22088272-22088465,22088561-22088753, 22088893-22089202,22089335-22089558,22089862-22089990, 22090019-22090078,22090426-22090617,22091463-22091522, 22091606-22091688,22092473-22092611,22092949-22093083, 22093187-22093462 Length = 928 Score = 27.1 bits (57), Expect = 4.2 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 3/66 (4%) Frame = +2 Query: 110 HQPNRNMATLKAISIRLKSVKN--IQKITQSMKMVSAAK-YTRAERDLKAARPYGEGAVQ 280 + P+R A +K + RLKS K ++++ + +SA K R +++ + A YG+ A+ Sbjct: 848 YDPDRERAQMKKMKKRLKSEKKGAMRELRKDNYFLSAVKEKERIKQEQERAEKYGK-AMA 906 Query: 281 FYERAE 298 F + E Sbjct: 907 FLQEQE 912 >04_01_0260 - 3506672-3508981 Length = 769 Score = 26.2 bits (55), Expect = 7.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +3 Query: 60 WDASDRVSAPKSWRWFTISQTGIWLL*RPFPSVLNL*KISRKSHSP*RW 206 W S P+SW + +G W + R F LNL + S++P R+ Sbjct: 331 WTYSYLNDRPRSWLHHALLCSGKWRMLRRFILSLNLFRFLVNSNNPTRY 379 >04_01_0254 + 3388215-3388553,3388869-3390830 Length = 766 Score = 26.2 bits (55), Expect = 7.4 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = +3 Query: 60 WDASDRVSAPKSWRWFTISQTGIWLL*RPFPSVLNL*KISRKSHSP*RWCQLLNT 224 W S P+SW + +G W + R F LNL + + P R+ L T Sbjct: 326 WTYSYLNDRPRSWLHHALLCSGKWRMLRRFILSLNLFRFLANNKKPTRYRMWLGT 380 >03_02_0846 + 11712530-11712740,11713974-11714055,11714127-11714226, 11714311-11714406,11714492-11714542,11714685-11714750, 11715413-11715514,11716099-11716167,11716251-11716334, 11716531-11716626,11717216-11717268,11718808-11718945, 11719003-11719435 Length = 526 Score = 26.2 bits (55), Expect = 7.4 Identities = 10/51 (19%), Positives = 27/51 (52%) Frame = +2 Query: 110 HQPNRNMATLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPY 262 + ++ + TL+ S + ++ +QK+++ + + S Y RD+ ++ Y Sbjct: 231 YNSDKMVGTLQVASTGIVALSYVQKVSEKVSLASDFMYNHMSRDVTSSFGY 281 >09_02_0365 + 7910800-7910874,7911735-7911842,7911957-7912046, 7912164-7912223,7912365-7912487 Length = 151 Score = 25.8 bits (54), Expect = 9.8 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +1 Query: 64 TLRTGCRHPSRGGGLPSAKQEYGYFEGHFHPS*ICEK 174 T TG + P R GG P K+ F G + S I K Sbjct: 2 TSSTGPKSPVRNGGSPPHKKSTSEFRGRKNESQILRK 38 >05_06_0049 + 25182075-25182332,25182624-25182882,25182986-25183204, 25183890-25184032,25184600-25184899 Length = 392 Score = 25.8 bits (54), Expect = 9.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 53 KMLGRFGPGVGTQVVAVVYHQPNRNMATLKAI 148 KML G+G V YH+P+R + A+ Sbjct: 165 KMLSSPEVGIGPYVEVAFYHKPSRTLLVTDAV 196 >05_01_0542 + 4729099-4729419,4730837-4731086,4731387-4731751 Length = 311 Score = 25.8 bits (54), Expect = 9.8 Identities = 13/48 (27%), Positives = 29/48 (60%) Frame = +2 Query: 113 QPNRNMATLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAAR 256 +P+ +A++ + R+K V +++K S +M +AAK +E ++A+ Sbjct: 247 EPDEEVASMD-VKDRIKKVASMKKKKSSKEMDTAAKIAASEAAARSAK 293 >02_04_0447 + 22998353-22999033,22999665-22999831,22999965-23000622 Length = 501 Score = 25.8 bits (54), Expect = 9.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 69 SDRVSAPKSWRWFTISQTGIWL 134 S RVS PK W ++S G W+ Sbjct: 453 SPRVSTPKEWLVRSVSSLGSWV 474 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,168,613 Number of Sequences: 37544 Number of extensions: 234492 Number of successful extensions: 604 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 530315984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -