BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1210 (353 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 23 0.81 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 23 0.81 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 21 3.3 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 5.7 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 5.7 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 20 7.5 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 20 7.5 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 20 7.5 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 20 7.5 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 20 7.5 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 20 7.5 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 20 7.5 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 20 7.5 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 20 9.9 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 20 9.9 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 20 9.9 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 20 9.9 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 20 9.9 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 20 9.9 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 20 9.9 AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase pro... 20 9.9 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 20 9.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 20 9.9 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 20 9.9 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 23.4 bits (48), Expect = 0.81 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 67 LRTGCRHPSRGGGLPSAKQ 123 L + C PSRG +PS+++ Sbjct: 12 LLSSCTRPSRGNAVPSSQR 30 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 23.4 bits (48), Expect = 0.81 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 67 LRTGCRHPSRGGGLPSAKQ 123 L + C PSRG +PS+++ Sbjct: 12 LLSSCTRPSRGNAVPSSQR 30 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 21.4 bits (43), Expect = 3.3 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -2 Query: 304 CNLSPFIELYCTFT--IGTSSFQVTLSTGVFS 215 C++SP + L C T + F V + GVFS Sbjct: 58 CDMSPLLSLVCADTRLNKLAVFIVAGAVGVFS 89 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 20.6 bits (41), Expect = 5.7 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -2 Query: 145 GLQSSHIPVWLMVNH 101 G +++P W+M NH Sbjct: 346 GTPQNNVPNWVMGNH 360 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 20.6 bits (41), Expect = 5.7 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 85 HPSRGGGLPSAKQEYGYFEGHFHP 156 +PS G LP + + + +HP Sbjct: 305 YPSTAGFLPPSYHPHQHHPSQYHP 328 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 239 DLKAARPYGEGAVQFYERAEV 301 D+ R GEG+ +ER E+ Sbjct: 156 DVMLKRRTGEGSKPIFEREEI 176 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 239 DLKAARPYGEGAVQFYERAEV 301 D+ R GEG+ +ER E+ Sbjct: 156 DVMLKRRTGEGSKPIFEREEI 176 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 239 DLKAARPYGEGAVQFYERAEV 301 D+ R GEG+ +ER E+ Sbjct: 156 DVMLKRRTGEGSKPIFEREEI 176 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 239 DLKAARPYGEGAVQFYERAEV 301 D+ R GEG+ +ER E+ Sbjct: 156 DVMLKRRTGEGSKPIFEREEI 176 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 239 DLKAARPYGEGAVQFYERAEV 301 D+ R GEG+ +ER E+ Sbjct: 156 DVMLKRRTGEGSKPIFEREEI 176 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 239 DLKAARPYGEGAVQFYERAEV 301 D+ R GEG+ +ER E+ Sbjct: 156 DVMLKRRTGEGSKPIFEREEI 176 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 239 DLKAARPYGEGAVQFYERAEV 301 D+ R GEG+ +ER E+ Sbjct: 156 DVMLKRRTGEGSKPIFEREEI 176 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 239 DLKAARPYGEGAVQFYERAEV 301 D+ R GEG+ +ER E+ Sbjct: 156 DVMLKRRTGEGSKPIFEREEI 176 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 19.8 bits (39), Expect = 9.9 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = +1 Query: 112 SAKQEYGYFEGHF 150 +++Q YG+F G+F Sbjct: 206 TSQQYYGHFAGNF 218 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 19.8 bits (39), Expect = 9.9 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = +3 Query: 147 FPSVLNL*KISRKS 188 +PSV+NL ++R+S Sbjct: 314 YPSVMNLDDLTRRS 327 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 19.8 bits (39), Expect = 9.9 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +2 Query: 206 VSAAKYTRAERDLKAARPYGEGAVQFYERAEV 301 V + T D+ R GEG+ +ER E+ Sbjct: 148 VEVKRDTINPEDVILIRRTGEGSKPIFEREEI 179 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 19.8 bits (39), Expect = 9.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 239 DLKAARPYGEGAVQFYERAEV 301 D+ R GEG+ +ER E+ Sbjct: 148 DVIVIRRTGEGSKPLFEREEI 168 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 19.8 bits (39), Expect = 9.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 239 DLKAARPYGEGAVQFYERAEV 301 D+ R GEG+ +ER E+ Sbjct: 159 DVIVIRRTGEGSKPLFEREEI 179 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 19.8 bits (39), Expect = 9.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 239 DLKAARPYGEGAVQFYERAEV 301 D+ R GEG+ +ER E+ Sbjct: 159 DVIVIRRTGEGSKPLFEREEI 179 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 19.8 bits (39), Expect = 9.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 239 DLKAARPYGEGAVQFYERAEV 301 D+ R GEG+ +ER E+ Sbjct: 148 DVIVIRRTGEGSKPLFEREEI 168 >AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase protein. Length = 85 Score = 19.8 bits (39), Expect = 9.9 Identities = 5/16 (31%), Positives = 10/16 (62%) Frame = -3 Query: 60 NILQILWVFIGKIYQS 13 N+ + W+F+G + S Sbjct: 33 NLSNLFWLFVGTYFPS 48 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 19.8 bits (39), Expect = 9.9 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +3 Query: 39 PIKFAKCWDASDRVSAPKSWRWFTI 113 P+K + S R SA RWF I Sbjct: 10 PVKSFRESRCSVRCSAASGLRWFEI 34 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 19.8 bits (39), Expect = 9.9 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +2 Query: 278 QFYERAEVTPP 310 +FY+ A+V PP Sbjct: 496 EFYKNADVRPP 506 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 19.8 bits (39), Expect = 9.9 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = +3 Query: 147 FPSVLNL*KISRKS 188 +PSV+NL ++R+S Sbjct: 314 YPSVMNLDDLTRRS 327 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,678 Number of Sequences: 438 Number of extensions: 2542 Number of successful extensions: 24 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8184330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -