BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1210 (353 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04640.1 68417.m00679 ATP synthase gamma chain 1, chloroplast... 49 1e-06 At1g15700.1 68414.m01884 ATP synthase gamma chain 2, chloroplast... 43 7e-05 At2g33040.1 68415.m04052 ATP synthase gamma chain, mitochondrial... 40 4e-04 At1g67623.1 68414.m07708 F-box family protein hypothetical prote... 27 4.7 At1g29080.1 68414.m03560 peptidase C1A papain family protein con... 26 6.3 >At4g04640.1 68417.m00679 ATP synthase gamma chain 1, chloroplast (ATPC1) identical to SP|Q01908 ATP synthase gamma chain 1, chloroplast precursor (EC 3.6.3.14) {Arabidopsis thaliana} Length = 373 Score = 48.8 bits (111), Expect = 1e-06 Identities = 23/50 (46%), Positives = 35/50 (70%) Frame = +2 Query: 131 ATLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQ 280 A+L+ + R+ SVKN QKIT++MK+V+AAK RA+ + RP+ E V+ Sbjct: 51 ASLRELRDRIDSVKNTQKITEAMKLVAAAKVRRAQEAVVNGRPFSETLVE 100 >At1g15700.1 68414.m01884 ATP synthase gamma chain 2, chloroplast (ATPC2) identical to SP|Q01909 ATP synthase gamma chain 2, chloroplast precursor (EC 3.6.3.14) {Arabidopsis thaliana}; contains Pfam profile: PF00231 ATP synthase; similar to ATP synthase gamma-subunit GI:21241 from [Spinacia oleracea] Length = 386 Score = 42.7 bits (96), Expect = 7e-05 Identities = 20/50 (40%), Positives = 34/50 (68%) Frame = +2 Query: 131 ATLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQ 280 A ++ + R+ SVKN QKIT++M++V+AA+ RA+ + RP+ E V+ Sbjct: 61 AGIRELRERIDSVKNTQKITEAMRLVAAARVRRAQDAVIKGRPFTETLVE 110 >At2g33040.1 68415.m04052 ATP synthase gamma chain, mitochondrial (ATPC) identical to SP|Q96250 ATP synthase gamma chain, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; contains Pfam profile: PF00231 ATP synthase Length = 325 Score = 40.3 bits (90), Expect = 4e-04 Identities = 27/77 (35%), Positives = 44/77 (57%) Frame = +2 Query: 122 RNMATLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQFYERAEV 301 R+++T + + R+KSVKNIQKIT++MKMV+A+K + + +R + F Sbjct: 41 RSIST-QVVRNRMKSVKNIQKITKAMKMVAASKLRAVQGRAENSRGLWQ---PFTALLGD 96 Query: 302 TPPEDDPKQLFVAMTSD 352 P D K + V ++SD Sbjct: 97 NPSIDVKKSVVVTLSSD 113 >At1g67623.1 68414.m07708 F-box family protein hypothetical protein ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 296 Score = 26.6 bits (56), Expect = 4.7 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +2 Query: 158 LKSVKNIQKITQSMKMVSAAKYTRAERDLKAAR--PYGEGAVQFYER-AEVTPPE 313 L +V+N++ +++S + + KY LK P+ E + +F ER E PE Sbjct: 44 LSAVRNLRLVSKSFRRICDEKYVFYRLSLKEIEFLPWHENSAKFIERCTESRNPE 98 >At1g29080.1 68414.m03560 peptidase C1A papain family protein contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas]; contains Pfam profile PF00112: Papain family cysteine protease Length = 346 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 210 DTIFMDCVIFWIFFTDLRRMEMAFKVAIF 124 D + CV+ IFF DL+ E +VA++ Sbjct: 2 DFVEFVCVVLTIFFMDLKISEATSRVALY 30 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,713,001 Number of Sequences: 28952 Number of extensions: 180131 Number of successful extensions: 387 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 387 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 449370720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -