BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1206 (667 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schiz... 25 7.4 SPCC16A11.12c |ubp1||ubiquitin C-terminal hydrolase Ubp1|Schizos... 25 9.8 >SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 926 Score = 25.4 bits (53), Expect = 7.4 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 470 NIRLHYIDCMSYVKLPMW*VIGFRLYLFLSFLY 568 N+RL Y CM Y+ + + GFR Y+ L Y Sbjct: 457 NLRLPYDSCMGYISNALNAIYGFR-YVALQDSY 488 >SPCC16A11.12c |ubp1||ubiquitin C-terminal hydrolase Ubp1|Schizosaccharomyces pombe|chr 3|||Manual Length = 849 Score = 25.0 bits (52), Expect = 9.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -1 Query: 214 CGLTRLVNGCCFNSHNNCKLQ**FVTSYKLIIEHVXPVTY 95 CGL L N C NS C + +T Y L + + Y Sbjct: 279 CGLYNLGNSCYMNSALQCMIHTHELTKYFLSDSYEKDINY 318 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,420,256 Number of Sequences: 5004 Number of extensions: 44812 Number of successful extensions: 66 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 303841898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -