BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1196 (421 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive ... 25 0.84 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 25 1.5 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 25 1.5 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 25 1.5 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 3.4 Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein... 22 7.9 >AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive chymotrypsin-likeserine protease-related protein ISPR1 protein. Length = 187 Score = 25.4 bits (53), Expect = 0.84 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -1 Query: 301 MAKRRIMVQIIPRVILRLPSTISSAPIDTSFTPFEA 194 + + +++V II ++L S S++PID +PF A Sbjct: 3 LKRGKMVVHIIFAILLACVSRGSASPIDHPISPFAA 38 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 24.6 bits (51), Expect = 1.5 Identities = 14/53 (26%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = -1 Query: 181 ALLTLAILWNRILPRSGLGRVSPEM-TSSSNMSFRPLRKSSSMFSMPVPAFLR 26 A L +I + ++L + G+ ++ + +NM+F+ + ++FS +P FLR Sbjct: 451 ATLIGSIYFGQVLDQDGVMNINGSLFLFLTNMTFQNVFAVINVFSAELPVFLR 503 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 24.6 bits (51), Expect = 1.5 Identities = 14/53 (26%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = -1 Query: 181 ALLTLAILWNRILPRSGLGRVSPEM-TSSSNMSFRPLRKSSSMFSMPVPAFLR 26 A L +I + ++L + G+ ++ + +NM+F+ + ++FS +P FLR Sbjct: 451 ATLIGSIYFGQVLDQDGVMNINGSLFLFLTNMTFQNVFAVINVFSAELPVFLR 503 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 24.6 bits (51), Expect = 1.5 Identities = 14/53 (26%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = -1 Query: 181 ALLTLAILWNRILPRSGLGRVSPEM-TSSSNMSFRPLRKSSSMFSMPVPAFLR 26 A L +I + ++L + G+ ++ + +NM+F+ + ++FS +P FLR Sbjct: 429 ATLIGSIYFGQVLDQDGVMNINGSLFLFLTNMTFQNVFAVINVFSAELPVFLR 481 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 3.4 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 190 KSSALLTLAILWNRILPRSGLGRVSPE 110 + A+ TL ++WN IL G+ PE Sbjct: 928 REGAVSTLGLVWNPILDTLGVKISEPE 954 >Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 22.2 bits (45), Expect = 7.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 208 TPFEAMKSSALLTLAILWNRILPRS 134 TP A ++ LTL+I+ +R LP S Sbjct: 2 TPLIATLAACALTLSIVHSRGLPES 26 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 428,071 Number of Sequences: 2352 Number of extensions: 7715 Number of successful extensions: 18 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -