BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1182 (525 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 26 0.67 AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. 23 4.7 AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. 23 4.7 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 8.3 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 26.2 bits (55), Expect = 0.67 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 411 RNCRYILLLNFELVSHDWW 467 R RY+ +LN E+V HD W Sbjct: 227 RATRYVHVLNAEIVLHDLW 245 >AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. Length = 167 Score = 23.4 bits (48), Expect = 4.7 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -2 Query: 167 ASSPCVLWLKLSLDHFEMYMLIWDYFLNV-LFAQMGNSVQQSHRYVRVREE 18 ASS C L+ S D M+ + W Y+ + Q G+S + Y E Sbjct: 48 ASSGCDASLRCSGDVCGMFAITWAYWADAGKPVQQGDSPDSQNAYANCANE 98 >AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. Length = 110 Score = 23.4 bits (48), Expect = 4.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 411 RNCRYILLLNFELVSHDW 464 R CRY L ++FE DW Sbjct: 18 RCCRYPLTVDFEKFGWDW 35 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 22.6 bits (46), Expect = 8.3 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -1 Query: 501 SDYPISYIVNDATNRETRVQNSIIVYNGSSSQI 403 S+YP + + ND+TN + N + +GS + Sbjct: 837 SEYPRTLVANDSTN-DLLSHNKVSSLHGSCDSL 868 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 599,144 Number of Sequences: 2352 Number of extensions: 13239 Number of successful extensions: 22 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48205926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -