BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1182 (525 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77770.2 68414.m09056 expressed protein 33 0.089 At1g77770.1 68414.m09055 expressed protein 33 0.089 >At1g77770.2 68414.m09056 expressed protein Length = 264 Score = 33.5 bits (73), Expect = 0.089 Identities = 23/69 (33%), Positives = 34/69 (49%) Frame = -3 Query: 331 ASSKYFAKYLPKYRP*LKSKGNQINNYCFSMFYLCRTHITGLNVLRDKRNTINRVQAVRV 152 A+S FA L +YR KS GN+ + + LCR + G V++D R N + R Sbjct: 59 ATSSRFANCLDQYR---KSYGNENSGQPELLCPLCRGQVKGWTVVKDARMHFNSKR--RT 113 Query: 151 CCG*NCRWI 125 C NC ++ Sbjct: 114 CMQDNCSFL 122 >At1g77770.1 68414.m09055 expressed protein Length = 265 Score = 33.5 bits (73), Expect = 0.089 Identities = 23/69 (33%), Positives = 34/69 (49%) Frame = -3 Query: 331 ASSKYFAKYLPKYRP*LKSKGNQINNYCFSMFYLCRTHITGLNVLRDKRNTINRVQAVRV 152 A+S FA L +YR KS GN+ + + LCR + G V++D R N + R Sbjct: 59 ATSSRFANCLDQYR---KSYGNENSGQPELLCPLCRGQVKGWTVVKDARMHFNSKR--RT 113 Query: 151 CCG*NCRWI 125 C NC ++ Sbjct: 114 CMQDNCSFL 122 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,008,454 Number of Sequences: 28952 Number of extensions: 256124 Number of successful extensions: 559 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -