Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-1146
         (618 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q6FPK9 Cluster: Candida glabrata strain CBS138 chromoso...    33   7.2  

>UniRef50_Q6FPK9 Cluster: Candida glabrata strain CBS138 chromosome
           J complete sequence; n=1; Candida glabrata|Rep: Candida
           glabrata strain CBS138 chromosome J complete sequence -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 573

 Score = 32.7 bits (71), Expect = 7.2
 Identities = 16/35 (45%), Positives = 25/35 (71%)
 Frame = +2

Query: 53  HPSPLLTHVLLSSPPTTIFSIPKHQSLLSSPHKKF 157
           H + + T   ++SPP+TI S+P HQS+LS P++ F
Sbjct: 173 HITRVNTPSSIASPPSTI-SLPFHQSVLSPPNQNF 206


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 409,617,324
Number of Sequences: 1657284
Number of extensions: 5943008
Number of successful extensions: 16410
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 15826
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16392
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 44807090004
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)