BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1146 (618 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 23 6.0 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 23 7.9 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 23.4 bits (48), Expect = 6.0 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 453 LKFFITTFRFAPSSSSILNND*YNVNNRITKP 548 L + +T FRF PS+ +I+ + +++ + I P Sbjct: 398 LAYLLTGFRFTPSAKTIVPME-FDIKSFILSP 428 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 23.0 bits (47), Expect = 7.9 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 453 LKFFITTFRFAPSSSSIL 506 L + + FRFAPSS +++ Sbjct: 458 LAYLLDGFRFAPSSKTVI 475 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 425,287 Number of Sequences: 2352 Number of extensions: 5764 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -