BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1144 (510 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_1058 - 30014796-30014961,30015711-30016450,30016756-300168... 27 6.6 >03_05_1058 - 30014796-30014961,30015711-30016450,30016756-30016887, 30017509-30018021,30019208-30019582 Length = 641 Score = 27.5 bits (58), Expect = 6.6 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -1 Query: 510 TPIVKKHSA*VHSRNALNLAE*VGLGGSTPRSSGIQLASINYANR*PIAS 361 TPI +K S+ + SRN L + VGL S G ++ SI P++S Sbjct: 395 TPIPQKKSSPLQSRNINVLNDSVGLNSSARSEFGRKVPSILQCRPVPLSS 444 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,040,267 Number of Sequences: 37544 Number of extensions: 182388 Number of successful extensions: 323 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 318 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 323 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1095026320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -