BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1144 (510 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 26 0.85 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 24 3.4 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 24 3.4 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 25.8 bits (54), Expect = 0.85 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -1 Query: 135 KLKLNLTMDLLANIGLLRRTNLRRELYTWRFKYIKNRALFHF*NL 1 ++ LN T D A + ++ +EL++WR K +A++H NL Sbjct: 272 RMVLNQTQDHRAIV----LASVAKELFSWRIMVKKMKAIYHTLNL 312 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.8 bits (49), Expect = 3.4 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -2 Query: 353 CLLYNIFTCDNDV 315 CL N++TCD+D+ Sbjct: 123 CLAENLYTCDDDL 135 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.8 bits (49), Expect = 3.4 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -2 Query: 353 CLLYNIFTCDNDV 315 CL N++TCD+D+ Sbjct: 123 CLAENLYTCDDDL 135 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 450,711 Number of Sequences: 2352 Number of extensions: 8911 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -