BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1144 (510 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15570.1 68416.m01973 phototropic-responsive NPH3 family prot... 28 3.2 At5g32613.1 68418.m03881 zinc knuckle (CCHC-type) family protein... 27 7.3 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 27 9.7 >At3g15570.1 68416.m01973 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 452 Score = 28.3 bits (60), Expect = 3.2 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +3 Query: 309 IDDIIIASEDVIKQTRNY*Q*VIDSRNLSTQAVYHSSE 422 ID + A V+KQ R +IDSR LS +A H+++ Sbjct: 252 IDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQ 289 >At5g32613.1 68418.m03881 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 457 Score = 27.1 bits (57), Expect = 7.3 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 429 YPQDPPIRLN*GHFCYVLTRCA 494 YP+ PP LN G + ++L+RC+ Sbjct: 308 YPRPPPKCLNCGRYGHLLSRCS 329 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 26.6 bits (56), Expect = 9.7 Identities = 18/70 (25%), Positives = 32/70 (45%) Frame = -1 Query: 393 INYANR*PIASNSLFAL*HLHLR**CRQCKLLFRVFKLNKETKTVTVTSKREIFIRIMKS 214 +NY N NS + +H + ++C ++F LN V + K + + I K Sbjct: 174 MNYYNHHLYGDNSFHHIWDIHQQD-QQECSMVFIPTILNTMQHKVAIKLKLKFKLNITKV 232 Query: 213 QSFNCILFVL 184 +FN +L +L Sbjct: 233 SAFNTLLLLL 242 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,284,678 Number of Sequences: 28952 Number of extensions: 160310 Number of successful extensions: 298 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 298 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 917929344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -