BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1134 (655 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 1.9 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 22 4.5 AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 22 4.5 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 6.0 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 7.9 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 500 TRRRQGREKGAHRTDRSRSQGDQGPERGNP 589 T++ Q GA S Q Q P+RG+P Sbjct: 10 TQQSQQPSSGAPGPQPSPHQSPQAPQRGSP 39 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +2 Query: 476 HHHRAEEGTRRRQGREKGAHRTDRSRSQGDQGPERGNP 589 + ++ E R +E+ +RT+R RS+ + NP Sbjct: 50 YKNKREYRKYRETSKERSRNRTERERSKEPKIISNNNP 87 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +2 Query: 461 IRRGSHHHRAEEGTRRRQGREKGAHRTDRSRSQGDQGPER 580 I R H R G +R+ R+K R + GP+R Sbjct: 3 ISRDHWHKRRATGGKRKPIRKKRKFELGRPAANTKLGPQR 42 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +1 Query: 373 TSTGIFQGSSSDVTRCLKARRLRLWNRGC 459 T +F G SD+ + L +W GC Sbjct: 241 TLVTMFTGLKSDIPPVAYVKALDVWMAGC 269 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 468 GVLTITAPRKVPDAVKGERKVPIAQTGPVRKEIKDQSE 581 G T T D + E +PI +TG K I ++ E Sbjct: 141 GKSTTTTVEVKRDIINPEDVIPIRRTGEGSKPIFEREE 178 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,247 Number of Sequences: 438 Number of extensions: 4079 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -